General Information |
MoonProt ID | 279 |
First appeared in release | 1.0 |
Name(s) | Germin
Oxalate oxidase 1
|
UniProt ID | P45850 (OXO1_HORVU), Reviewed |
GO terms | GO:0006950 response to stress
GO:0055114 oxidation-reduction process
GO:0016491 oxidoreductase activity
GO:0030145 manganese ion binding
GO:0045735 nutrient reservoir activity
GO:0046872 metal ion binding
GO:0050162 oxalate oxidase activity
GO:0005576 extracellular region
GO:0005618 cell wall
GO:0048046 apoplast |
Organisms for which functions have been demonstrated | Hordeum vulgare |
Sequence length | 201 |
FASTA sequence | >1FI2:A|PDBID|CHAIN|SEQUENCE
TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
|
Structure Information |
PDB ID | 1FI2 |
Quaternary structure | |
SCOP | Double-stranded beta-helix |
CATH | 2.60.120.10 |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-2, 197-201 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Oxalate oxidase, enzyme
Oxalate + O2 + 2 H+ => 2 CO2 + H2O2 |
References for function | |
E.C. number | 1.2.3.4 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | superoxide dismutase, enzyme
2 superoxide (O2-) + 2 H(+) <=> O(2) + H(2)O(2) |
References for function | Woo EJ, Dunwell JM, Goodenough PW, Marvier AC, Pickersgill RW. Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities. Nat Struct Biol. 2000 Nov;7(11):1036-40.
PMID: 11062559 |
E.C. number | 1.15.1.1 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |