General Information |
MoonProt ID | 485 |
First appeared in release | 3.0 |
Name(s) | DNA-(apurinic or apyrimidinic site) endonuclease; APEX1; APE1; Redox factor 1; Ref-1 |
UniProt ID | P43138 (APEX1_RAT) |
GO terms | GO:0004528 phosphodiesterase I activity
GO:0005634 nucleus
GO:0008311 double-stranded DNA 3'-5' exodeoxyribonuclease activity
GO:0006284 base-excision repair
GO:0043488 regulation of mRNA stability
GO:0005730 nucleolus
GO:0006281 DNA repair
GO:0080111 DNA demethylation
GO:0042981 regulation of apoptotic process
GO:0031490 chromatin DNA binding
GO:0016890 site-specific endodeoxyribonuclease activity
GO:0016607 nuclear speck
GO:0008408 3'-5' exonuclease activity
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0003684 damaged DNA binding
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0006281 DNA repair
GO:0003677 DNA binding
GO:0016787 hydrolase activity |
Organisms for which functions have been demonstrated | Rattus norvegicus (Rat) |
Sequence length | 317 amino acids |
FASTA sequence | >sp|P43138|APEX1_RAT DNA-(apurinic or apyrimidinic site) endonuclease OS=Rattus norvegicus OX=10116 GN=Apex1 PE=1 SV=2
MPKRGKRAAAEDGEEPKSEPETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSASGKSATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFILVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGEMLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
Structure Information |
PDB ID | NA |
Quaternary structure | hoimodimer |
SCOP | |
CATH | |
TM Helix Prediction | no TM helices
# sp|P43138|APEX1_RAT Number of predicted TMHs: 0
# sp|P43138|APEX1_RAT Exp number of AAs in TMHs: 0.11635
# sp|P43138|APEX1_RAT Exp number, first 60 AAs: 0
# sp|P43138|APEX1_RAT Total prob of N-in: 0.08508
sp|P43138|APEX1_RAT TMHMM2.0 outside 1 317 |
DisProt Annotation | |
Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
sp_P43138_APEX1_RAT_DNA_ is 317 residues long, with 60 residues (18.93 %) predicted as disordered. The protein has 0 short (< 30 residues) disorder segments and 1 long (>= 30 residues) disorder segment.
Segment 1 - Long (>= 30 residues) disordered segment
Segment is located between positions 1 and 60 in the sequence.
The segment is 60 residues long (18.93 % of the total sequence length). |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | DNA repair |
References for function | Bagnyukova TV, Powell CL, Pavliv O, Tryndyak VP, Pogribny IP. Induction of oxidative stress and DNA damage in rat brain by a folate/methyl-deficient diet. Brain research. 2008 Oct 27;1237:44-51. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | nucleus |
Comments | |
Function 2 |
Function description | redox regulation of transcriptional factors |
References for function | Bagnyukova TV, Powell CL, Pavliv O, Tryndyak VP, Pogribny IP. Induction of oxidative stress and DNA damage in rat brain by a folate/methyl-deficient diet. Brain research. 2008 Oct 27;1237:44-51. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | nucleus |
Comments | |