| General Information |
| MoonProt ID | 10 |
| First appeared in release | 1.0 |
| Name(s) | 6-phosphofructokinase
Phosphofructokinase
Phosphohexokinase
pfkA
|
| UniProt ID | E6KMA1 (E6KMA1_STROR), Unreviewed |
| GO terms | GO:0006002 fructose 6-phosphate metabolic process
GO:0006096 glycolysis
GO:0016310 phosphorylation
GO:0000166 nucleotide binding
GO:0003872 6-phosphofructokinase activity
GO:0005524 ATP binding
GO:0008443 phosphofructokinase activity
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0046872 metal ion binding
GO:0005737 cytoplasm
GO:0005945 6-phosphofructokinase complex |
| Organisms for which functions have been demonstrated | Streptococcus oralis LA11 - oral streptococci (Gram positive bacterium) |
| Sequence length | 335 |
| FASTA sequence | >gi|446743625|ref|WP_000820881.1| 6-phosphofructokinase [Streptococcus oralis]
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIYPLDAASVGDIISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRNAGDIALWAGIATGADEIIIPEEGFKMEDIVASIKAGYEHGKKHNIIVLAEGVMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKQGIGGVAVGIRNEKMVENPILGTAEEGALFSLTADGKIVVNNPHKADLELSDLNKSLS |
| Structure Information |
| PDB ID | closest homologue with structure in the PDB has 62% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), middle regions (aa 246-254, 256-262), and C terminus (aa 329-335) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | 6-phosphofructokinase, enzyme
ATP + D-fructose 6-phosphate => ADP + D-fructose 1,6-bisphosphate
Carbohydrate degradation, glycolysis |
| References for function | |
| E.C. number | 2.7.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen from host organism |
| References for function | Kinnby B, Booth NA, Svensater G. Plasminogen binding by oral streptococci from dental plaque and inflammatory lesions. Microbiology 2008; 154: 924931.
PMID: 18310038 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |