| General Information |
| MoonProt ID | 103 |
| First appeared in release | 4.0 |
| Name(s) | vacuolar protein sorting-associated 26A |
| UniProt ID | Q9FJD0 |
| GO terms | GO:0003674 molecular_function
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0033233 regulation of protein sumoylation
GO:0042147 retrograde transport, endosome to Golgi
GO:0005768 endosome
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005771 multivesicular body
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0009507 chloroplast
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030904 retromer complex
GO:0030906 retromer, cargo-selective complex |
| Organisms for which functions have been demonstrated | Arabidopsis thaliana (Mouse-ear cress) |
| Sequence length | 302 |
| FASTA sequence | >sp|Q9FJD0|VP26A_ARATH Vacuolar protein sorting-associated protein 26A OS=Arabidopsis thaliana OX=3702 GN=VPS26A PE=2 SV=1
MNYLLGAFKPACNISITFTDGKNRKQVPTKKDNGQIVMNPLFQSQETIAGKINIEPYQGK
KVEHNGVKVELLGQIEMYFDRGNFYDFTSLVREIDVPGEIYERKTYPFEFSSVEMPYETY
NGVNVRLRYVLKVTVTRGYAGSIVEYQDFVVRNYVPLPPINNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVILGKIYFLLVRIKIKNMDLEIRRRESTGAGANTHVETETLAKFELMDGAP
VRGESIPVRVFLTPYDLTPTHKNINNKFSVKYYLNLVLVDEEDRRYFKQQEITLYRLKEE
TS |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of the VPS26-VPS29-VPS35 retromer complex |
| References for function | Lou F, Zhou W, Tunc-Ozdemir M, Yang J, Velazhahan V, Tate CG, Jones AM. VPS26 Moonlights as a Beta-Arrestin-like Adapter for a 7-Transmembrane RGS Protein in Arabidopsis thaliana. Biochemistry. 2024 Nov 19;63(22):2990-2999. doi: 10.1021/acs.biochem.4c00361. Epub 2024 Oct 28. PMID: 39467170; PMCID: PMC11580166. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds RGS1 7TM protein to regulate its downstream signaling |
| References for function | Lou F, Zhou W, Tunc-Ozdemir M, Yang J, Velazhahan V, Tate CG, Jones AM. VPS26 Moonlights as a Beta-Arrestin-like Adapter for a 7-Transmembrane RGS Protein in Arabidopsis thaliana. Biochemistry. 2024 Nov 19;63(22):2990-2999. doi: 10.1021/acs.biochem.4c00361. Epub 2024 Oct 28. PMID: 39467170; PMCID: PMC11580166. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasmic side of membrane |
| Comments | |