| General Information |
| MoonProt ID | 104 |
| First appeared in release | 4.0 |
| Name(s) | vacuolar protein sorting-associated 26B |
| UniProt ID | Q9T091 |
| GO terms | GO:0003674 molecular_function
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0042147 retrograde transport, endosome to Golgi
GO:0005768 endosome
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0009507 chloroplast
GO:0010008 endosome membrane
GO:0030906 retromer, cargo-selective complex |
| Organisms for which functions have been demonstrated | Arabidopsis thaliana (Mouse-ear cress) |
| Sequence length | 303 |
| FASTA sequence | >sp|Q9T091|VP26B_ARATH Vacuolar protein sorting-associated protein 26B OS=Arabidopsis thaliana OX=3702 GN=VPS26B PE=2 SV=2
MNYLLGAFKPACNISITFSDGKNRKQVPMKKENGQTALVPLFHSQDTISGKVCIEPYQGK
KVEHNGVKVELLGQIEMYFDRGNFYDFTSLVRELDVPGEIYERKTYPFEFPTVEMPYETY
NGVNVRLRYVLKVTVTRGYAGSILEYQELVVRNYAPLPDINNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVILGKIYFLLVRIKMKNMDLEIRRRESTGAGANTHVETETLAKFELMDGTP
VRGESIPVRLFLAPYDLTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITLYRLKED
ASS |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-4), middle regions (aa 26-32), and C terminus (aa 299-303) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of the VPS26-VPS29-VPS35 retromer complex |
| References for function | Lou F, Zhou W, Tunc-Ozdemir M, Yang J, Velazhahan V, Tate CG, Jones AM. VPS26 Moonlights as a Beta-Arrestin-like Adapter for a 7-Transmembrane RGS Protein in Arabidopsis thaliana. Biochemistry. 2024 Nov 19;63(22):2990-2999. doi: 10.1021/acs.biochem.4c00361. Epub 2024 Oct 28. PMID: 39467170; PMCID: PMC11580166. |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds RGS1 7TM protein to regulate its downstream signaling |
| References for function | Lou F, Zhou W, Tunc-Ozdemir M, Yang J, Velazhahan V, Tate CG, Jones AM. VPS26 Moonlights as a Beta-Arrestin-like Adapter for a 7-Transmembrane RGS Protein in Arabidopsis thaliana. Biochemistry. 2024 Nov 19;63(22):2990-2999. doi: 10.1021/acs.biochem.4c00361. Epub 2024 Oct 28. PMID: 39467170; PMCID: PMC11580166. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasmic side of membrane |
| Comments | |