| General Information |
| MoonProt ID | 106 |
| First appeared in release | 4.0 |
| Name(s) | riboflavin kinase RbkR |
| UniProt ID | NA |
| GO terms | NA |
| Organisms for which functions have been demonstrated | Thermoplasma acidophilum |
| Sequence length | NA |
| FASTA sequence | >5TRD_1|Chains A, B|Riboflavin kinase|Thermoplasma acidophilum (273075)
MSLETDDQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDKYLREEINLHDGDRVSVEVYTEGHHHHHH |
| Structure Information |
| PDB ID | 5TRD |
| Quaternary structure | NA |
| SCOP | 3000034, 3000036 |
| CATH | 1.10.10.10, 2.40.30.30 |
| TM Helix Prediction | |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, riboflavin kinase |
| References for function | Rodionova IA, Vetting MW, Li X, Almo SC, Osterman AL, Rodionov DA. A novel bifunctional transcriptional regulator of riboflavin metabolism in Archaea. Nucleic Acids Res. 2017 Apr 20;45(7):3785-3799. doi: 10.1093/nar/gkw1331. PMID: 28073944; PMCID: PMC5397151. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | DNA binding transcription regulator |
| References for function | Rodionova IA, Vetting MW, Li X, Almo SC, Osterman AL, Rodionov DA. A novel bifunctional transcriptional regulator of riboflavin metabolism in Archaea. Nucleic Acids Res. 2017 Apr 20;45(7):3785-3799. doi: 10.1093/nar/gkw1331. PMID: 28073944; PMCID: PMC5397151. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | binding to DNA |
| Comments | |