| General Information |
| MoonProt ID | 115 |
| First appeared in release | 1.0 |
| Name(s) | L-lactate dehydrogenase B chain
lactate dehydrogenase B
Epsilon-crystallin
LDH-B
Gene Name: LDHB |
| UniProt ID | P13743 (LDHB_ANAPL) Reviewed |
| GO terms | GO: 0005975 carbohydrate metabolic process
GO: 0006096 glycolysis
GO: 0044262 cellular carbohydrate metabolic process
GO: 0055114 oxidation-reduction process
GO: 0003824 catalytic activity
GO: 0004459 L-lactate dehydrogenase activity
GO: 0005212 structural constituent of eye lens
GO: 0016491 oxidoreductase activity
GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO: 0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Anas platyrhynchos (Mallard duck) - also in reptiles, swans, geese, ostriches |
| Sequence length | 333 |
| FASTA sequence | >sp|P13743|LDHB_ANAPL L-lactate dehydrogenase B chain OS=Anas platyrhynchos GN=LDHB PE=1 SV=2
MATLKEKLMTPVAAASAVPSSKITVVGVGQVGMACAVSILGKGLCDELALVDVLEDKLKGEMMDLQHGSLFLQTHKIVADKDYAVTANSKIVVVTAGVRQQEGESRLNLVQRNVGVFKGIIPQIVKYSPNCTILVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDTARFRYLMAERLGIHPTSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPAMGTDKDSENWKEVHKQVVESAYEVIRLKGYTNWAIGLSVAELCETMLKNLCRVHSVSTLVKGTYGIENDVFLSLPCVLSASGLTSVINQKLKDDEVAQLKKSADTLWSIQKDLKDM
|
| Structure Information |
| PDB ID | closest is chicken at 98% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-14, 331-333 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | lactate dehydrogenase, enzyme
lactate + NAD+ <=> pyruvate + NADH
pyruvate fermentation to lactate |
| References for function | Hendriks W., Mulders J.W.M., Bibby M.A., Slingsby C., Bloemendal H., de Jong W.W., Mulders JW., Bibby MA., de Jong WW. Duck lens epsilon-crystallin and lactate dehydrogenase B4 are identical: A single-copy gene product with two distinct functions. (1988) Pro. Natl. Acad. Sci. U.S.A. 85(19), 7114-8.
Wistow G.J., Mulders J.W.M., de Jong W.W., The enzyme lactate dehydrogenase as a structural protein in avian and crocodilian lenses. (1987) Nature 326, 622-624. |
| E.C. number | 1.1.1.27 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Structural eye lens protein (epsilon-crystallin)- also in crocodile, hummingbird, chimney swift |
| References for function | Hendriks W., Mulders J.W.M., Bibby M.A., Slingsby C., Bloemendal H., de Jong W.W., Mulders JW., Bibby MA., de Jong WW. Duck lens epsilon-crystallin and lactate dehydrogenase B4 are identical: A single-copy gene product with two distinct functions. (1988) Pro. Natl. Acad. Sci. U.S.A. 85(19), 7114-8.PMID: 3174623 .
Piatigorsky J. Multifunctional lens crystallins and corneal enzymes. More than meets the eye. (1998). Annals NY Academy Sci. 842(1), 2-15.PMID: 9599288.
Wistow G.J., Mulders J.W.M., de Jong W.W., The enzyme lactate dehydrogenase as a structural protein in avian and crocodilian lenses. (1987) Nature 326, 622-624.
PMID: 3561501 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | lens of the eye |
| Comments | |