General Information |
MoonProt ID | 116 |
First appeared in release | 1.0 |
Name(s) | Iota-crystallin
CRBPI
crystallin
cellular retinol binding protein 1 |
UniProt ID | Q9I9A9 (Q9I9A9_9SAUR), Unreviewed |
GO terms | |
Organisms for which functions have been demonstrated | Lygodactylus luteopicturatus (Yellow-headed Dwarf Gecko) |
Sequence length | 128 |
FASTA sequence | >tr|Q9I9A9|Q9I9A9_9SAUR Iota-crystallin (Fragment) OS=Lygodactylus luteopicturatus GN=CRBPI PE=2 SV=1
YYRFVSQDNMDNYLRVLDINVALRKLVCLLKPDKEIIHNGNHMTIRTLTTLRNYIMDFDLGTEFEEDLGPVDGRKCQTIVQWNGDKLVCEQHGEKKNRGWKQWLEGDFLHLHMSAEDETCIQIFEKIK
|
Structure Information |
PDB ID | closest is human at 62% amino acid sequence identity |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-13, |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Cellular retinol-binding protein Type 1
carrier protein involved in transport of retinol from liver to peripheral tissues |
References for function | Werten PJL, Roll B, van Aalten DMF, de Jong WW. (2000) Gecko iota-crystallin: How cellular retinol-binding protein became an eye lens ultraviolet filter. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3282-7.
PMID: 10725366 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | crystallin
Ultraviolet Filter Lens protein |
References for function | Roll B, Amons R, de Jong WW. (1996) Vitamin A2 bound to cellular retinol-binding protein as ultraviolet filter in the eye lens of the gecko Lygodactylus picturatus. J Biol Chem. 271:10437-40. PMID: 8631836.
Werten PJL, Roll B, van Aalten DMF, de Jong WW. (2000) Gecko iota-crystallin: How cellular retinol-binding protein became an eye lens ultraviolet filter. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3282-7.
PMID: 10725366. |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | lens of eye |
Comments | |