| General Information |
| MoonProt ID | 116 |
| First appeared in release | 1.0 |
| Name(s) | Iota-crystallin
CRBPI
crystallin
cellular retinol binding protein 1 |
| UniProt ID | Q9I9A9 (Q9I9A9_9SAUR), Unreviewed |
| GO terms | |
| Organisms for which functions have been demonstrated | Lygodactylus luteopicturatus (Yellow-headed Dwarf Gecko) |
| Sequence length | 128 |
| FASTA sequence | >tr|Q9I9A9|Q9I9A9_9SAUR Iota-crystallin (Fragment) OS=Lygodactylus luteopicturatus GN=CRBPI PE=2 SV=1
YYRFVSQDNMDNYLRVLDINVALRKLVCLLKPDKEIIHNGNHMTIRTLTTLRNYIMDFDLGTEFEEDLGPVDGRKCQTIVQWNGDKLVCEQHGEKKNRGWKQWLEGDFLHLHMSAEDETCIQIFEKIK
|
| Structure Information |
| PDB ID | closest is human at 62% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-13, |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Cellular retinol-binding protein Type 1
carrier protein involved in transport of retinol from liver to peripheral tissues |
| References for function | Werten PJL, Roll B, van Aalten DMF, de Jong WW. (2000) Gecko iota-crystallin: How cellular retinol-binding protein became an eye lens ultraviolet filter. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3282-7.
PMID: 10725366 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | crystallin
Ultraviolet Filter Lens protein |
| References for function | Roll B, Amons R, de Jong WW. (1996) Vitamin A2 bound to cellular retinol-binding protein as ultraviolet filter in the eye lens of the gecko Lygodactylus picturatus. J Biol Chem. 271:10437-40. PMID: 8631836.
Werten PJL, Roll B, van Aalten DMF, de Jong WW. (2000) Gecko iota-crystallin: How cellular retinol-binding protein became an eye lens ultraviolet filter. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3282-7.
PMID: 10725366. |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | lens of eye |
| Comments | |