| General Information |
| MoonProt ID | 117 |
| First appeared in release | 1.0 |
| Name(s) | L-lactate dehydrogenase
crystallin (upsilon)
lactate dehydrogenase A |
| UniProt ID | Q7YQK6 (Q7YQK6_ORNAN), Unreviewed |
| GO terms | GO: 0005975 carbohydrate metabolic process
GO: 0006096 glycolysis GO: 0044262 cellular carbohydrate metabolic process
GO: 0055114 oxidation-reduction process
GO: 0003824 catalytic activity
GO: 0004459 L-lactate dehydrogenase activity
GO: 0016491 oxidoreductase activity
GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO: 0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Ornithorhynchus anatinus (Duckbill platypus) |
| Sequence length | 332 |
| FASTA sequence | >tr|Q7YQK6|Q7YQK6_ORNAN L-lactate dehydrogenase OS=Ornithorhynchus anatinus PE=2 SV=1
MAGVKEQLIQNLLKEEYAPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGIHSTSCHGWVIGEHGDSSVPVWSGVNVAGVSLKNLHPDLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIVKNLRRVHPISTMIKGLYGIKDEVFLSVPCVLGQNGISDVVKITLKSEEEAHLKKSADTLWGIQKELQF
|
| Structure Information |
| PDB ID | closest is rabbit with 93% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Lactate dehydrogenase A, enzyme
Fermentation, Pyruvate fermentation to lactate
pyruvate + NADH <=> lactate + NAD+
Catalyzes the conversion of pyruvate (final product of glycolysis) to lactate |
| References for function | van Rheede T, Amons R, Stewart N, de Jong WW. (2003) Lactate dehydrogenase A as a highly abundant eye lens protein in the platypus (Ornithorhynchus anatinus): upsilon crystallin. Mol Biol Evol. 2003 Jun;20(6):994-8. Epub 2003 Apr 25.
PMID: 12716980 |
| E.C. number | 1.1.1.27 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Lens protein crystallin |
| References for function | van Rheede T, Amons R, Stewart N, de Jong WW. (2003) Lactate dehydrogenase A as a highly abundant eye lens protein in the platypus (Ornithorhynchus anatinus): upsilon crystallin. Mol Biol Evol. 2003 Jun;20(6):994-8. Epub 2003 Apr 25.
PMID: 12716980 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | lens of eye |
| Comments | |