General Information |
MoonProt ID | 117 |
First appeared in release | 1.0 |
Name(s) | L-lactate dehydrogenase
crystallin (upsilon)
lactate dehydrogenase A |
UniProt ID | Q7YQK6 (Q7YQK6_ORNAN), Unreviewed |
GO terms | GO: 0005975 carbohydrate metabolic process
GO: 0006096 glycolysis GO: 0044262 cellular carbohydrate metabolic process
GO: 0055114 oxidation-reduction process
GO: 0003824 catalytic activity
GO: 0004459 L-lactate dehydrogenase activity
GO: 0016491 oxidoreductase activity
GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO: 0005737 cytoplasm |
Organisms for which functions have been demonstrated | Ornithorhynchus anatinus (Duckbill platypus) |
Sequence length | 332 |
FASTA sequence | >tr|Q7YQK6|Q7YQK6_ORNAN L-lactate dehydrogenase OS=Ornithorhynchus anatinus PE=2 SV=1
MAGVKEQLIQNLLKEEYAPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGIHSTSCHGWVIGEHGDSSVPVWSGVNVAGVSLKNLHPDLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIVKNLRRVHPISTMIKGLYGIKDEVFLSVPCVLGQNGISDVVKITLKSEEEAHLKKSADTLWGIQKELQF
|
Structure Information |
PDB ID | closest is rabbit with 93% amino acid sequence identity |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Lactate dehydrogenase A, enzyme
Fermentation, Pyruvate fermentation to lactate
pyruvate + NADH <=> lactate + NAD+
Catalyzes the conversion of pyruvate (final product of glycolysis) to lactate |
References for function | van Rheede T, Amons R, Stewart N, de Jong WW. (2003) Lactate dehydrogenase A as a highly abundant eye lens protein in the platypus (Ornithorhynchus anatinus): upsilon crystallin. Mol Biol Evol. 2003 Jun;20(6):994-8. Epub 2003 Apr 25.
PMID: 12716980 |
E.C. number | 1.1.1.27 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | Lens protein crystallin |
References for function | van Rheede T, Amons R, Stewart N, de Jong WW. (2003) Lactate dehydrogenase A as a highly abundant eye lens protein in the platypus (Ornithorhynchus anatinus): upsilon crystallin. Mol Biol Evol. 2003 Jun;20(6):994-8. Epub 2003 Apr 25.
PMID: 12716980 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | lens of eye |
Comments | |