| General Information |
| MoonProt ID | 120 |
| First appeared in release | 1.0 |
| Name(s) | Quinone oxidoreductase
NADPH:quinone reductase
Zeta-crystallin
Gene Name: CRYZ |
| UniProt ID | P11415 (QOR_CAVPO) Reviewed |
| GO terms | GO:0042178 xenobiotic catabolic process
GO:0051289 protein homotetramerization
GO:0055114 oxidation-reduction process
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0003960 NADPH:quinone reductase activity
GO:0005212 structural constituent of eye lens
GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity
GO:0070402 NADPH binding
GO:0070404 NADH binding
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle |
| Organisms for which functions have been demonstrated | Cavia porcellus (Guinea pig) |
| Sequence length | 329 |
| FASTA sequence | >sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1
MATGQKLMRAIRVFEFGGPEVLKVQSDVAVPIPKDHQVLIKVHACGINPVETYIRSGTYTRIPLLPYTPGTDVAGVVESIGNDVSAFKKGDRVFTTSTISGGYAEYALASDHTVYRLPEKLDFRQGAAIGIPYFTACRALFHSARAKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKVVLQNGAHEVFNHRDAHYIDEIKKSIGEKGVDVIIEMLANVNLSNDLKLLSCGGRVIIVGCRGSIEINPRDTMAKESTISGVSLFSSTKEEFQQFASTIQAGMELGWVKPVIGSQYPLEKASQAHENIIHSSGTVGKTVLLM |
| Structure Information |
| PDB ID | closest is human with 83% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-4), and C terminus (aa 324-329) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Quinone oxidoreductase
NADPH:quinone oxidoreductase
NADPH + 2 quinone <=> NADP(+) + 2 semiquinone
|
| References for function | Identification and characterization of the enzymatic activity of zeta-crystallin from guinea pig lens. A novel NADPH:quinone oxidoreductase. Rao P.V., Krishna C.M., Zigler J.S. Jr.J. Biol. Chem. 267:96-102(1992).
PMID: 1370456.
Zeta-crystallin from guinea pig lens is capable of functioning catalytically as an oxidoreductase. Rao, P. V., and Zigler, J. S., Jr. (1990) Biochem. Biophys. Res. Commun. 167,1221-1228. PMID: 1989495 |
| E.C. number | 1.6.5.5 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Zeta-crystallin
(Also in camels, llamas, and tree frog) |
| References for function | Zeta-crystallin, a novel lens protein from the guinea pig.
Huang QL, Russell P, Stone SH, Zigler JS Jr. Curr Eye Res. 1987 May;6(5):725-32.
PMID: 3595182
|
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | lens of the eye |
| Comments | |