| General Information |
| MoonProt ID | 121 |
| First appeared in release | 1.0 |
| Name(s) | Zeta-crystallin
NADPH:quinone oxidoreductase |
| UniProt ID | Q98TD4 (Q98TD4_HYLJA) Unreviewed |
| GO terms | GO:0055114 oxidation-reduction process
GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity |
| Organisms for which functions have been demonstrated | Hyla japonica (Japanese tree frog) |
| Sequence length | 329 |
| FASTA sequence | >tr|Q98TD4|Q98TD4_HYLJA Zeta-crystallin OS=Hyla japonica PE=2 SV=1
MASVDRFMRAIRVNEFGKPDVLKLMTDVPVPSPGENQVLIRVHACGINPFESYIRSGLFAWRPSLPYTPGSDTSGVVEAVGRNVTGFKKGDRVFTRSTITGGYAEYTVACEDMVYHLPDHLNFKQGAALAIPYFTAYRALFQKAHAKPGELILIHGASGGVGIAACQLARAYGFKVFGTAGTPKGLNLVMQNGAHKVFNHREKDYIEKIQEAAGGEGVDVILEMLANCNLCNDLKLLSYGGRVVVLGSQGSVDINPTDIIAKETSIIGHSLYSSTKEEWKEARAAIFGGMESGWLKPLIGPEYPLEKASQAHEDLTQDSGATGKMVLVL |
| Structure Information |
| PDB ID | closest is human with 63% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-5, |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | NADPH:quinone oxidoreductase, enzyme |
| References for function | |
| E.C. number | 1.6.99.2 |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | Zeta crystallin
(Also in camel, llamas and Guinea pig) |
| References for function | Taxon-specific zeta-Crystallin in Japanese Tree Frog (Hyla japonica) Lens. Fujii Y., Kimoto H., Ishikawa K., Watanabe K., Yokota Y., Nakai N., Taketo A. J Biol Chem. 2001 Jul 27;276(30):28134-9. Epub 2001 May 22.
PMID: 11371565 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | lens of the eye |
| Comments | |