General Information |
MoonProt ID | 122 |
First appeared in release | 1.0 |
Name(s) | Pterin-4-alpha-carbinolamine dehydratase
PHS
4-alpha-hydroxy-tetrahydropterin dehydratase,
Dimerization cofactor of hepatocyte nuclear factor 1-alpha
DCoH
Dimerization cofactor of HNF1?
Phenylalanine hydroxylase-stimulating protein
Pterin carbinolamine dehydratase
PCD
Dcoh
Pcbd
Gene Name: Pcbd1 |
UniProt ID | P61459 (PHS_RAT), Reviewed |
GO terms | GO:0006351 transcription, DNA-templated
GO:0006355 regulation of transcription, DNA-templated
GO:0006558 L-phenylalanine metabolic process
GO:0006729 tetrahydrobiopterin biosynthetic process
GO:0008150 biological_process
GO:0043496 regulation of protein homodimerization activity GO:0045893 positive regulation of transcription, DNA-templated
GO:0051289 protein homotetramerization
GO:0051291 protein heterooligomerization
GO:0055114 oxidation-reduction process
GO:0003674 molecular_function
GO:0003713 transcription coactivator activity
GO:0004505 phenylalanine 4-monooxygenase activity
GO:0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity GO:0016829 lyase activity
GO:0042802 identical protein binding
GO:0005575 cellular_component
GO:0005634 nucleus
GO:0005737 cytoplasm |
Organisms for which functions have been demonstrated | Rattus norvegicus |
Sequence length | 104 |
FASTA sequence | >gi|47606443|sp|P61459.2|PHS_RAT RecName: Full=Pterin-4-alpha-carbinolamine dehydratase; Short=PHS; AltName: Full=4-alpha-hydroxy-tetrahydropterin dehydratase; AltName: Full=Dimerization cofactor of hepatocyte nuclear factor 1-alpha; Short=DCoH; Short=Dimerization cofactor of HNF1; AltName: Full=Phenylalanine hydroxylase-stimulating protein; AltName: Full=Pterin carbinolamine dehydratase; Short=PCD MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
Structure Information |
PDB ID | 1DCH 1DCP 1F93(with binding partner) |
Quaternary structure | |
SCOP | DCoH-like |
CATH | 3.30.1360.20 |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Pterin-4-alpha-carbinolamine dehydratase, enzyme
convert 4a-hydroxy tetrahydropterin to quinonoid dihydrobiopterin, in phenylalanine hydroxylation reaction
(6R)-6-(L-erythro-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4a-hydroxypterin => (6R)-6-(L-erythro-1,2-dihydroxypropyl)-7,8-dihydro-6H-pterin + H2O |
References for function | |
E.C. number | 4.2.1.96 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | dimerization of hepatocyte nuclear factor 1? (HNF1A), a homeodomain transcription factor, results in transcription activation
|
References for function | Citron BA, Davis MD, Milstien S, Gutierrez J, Mendel DB, Crabtree GR, Kaufman S. Identity of 4a-carbinolamine dehydratase, a component of the phenylalanine hydroxylation system, and DCoH, a transregulator of homeodomain proteins. Proc Natl Acad Sci U S A. 1992 Dec 15. PMID: 1465414 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | nucleus |
Comments | |