| General Information |
| MoonProt ID | 13 |
| First appeared in release | 1.0 |
| Name(s) | Alcohol dehydrogenase
ADH1
Alcohol dehydrogenase 1
40 kDa allergen
Allergen Can a 1
Allergen Can a I
Allergen = Cand a 1
Gene Name: ADH1
|
| UniProt ID | P43067 (ADH1_CANAX), Reviewed |
| GO terms | GO:0055114 oxidation-reduction process
GO:0004022 alcohol dehydrogenase (NAD) activity
GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 350 |
| FASTA sequence | >gi|608690|emb|CAA57342.1| alcohol dehydrogenase [Candida albicans]
MSEQIPKTQKAVVFDTNGGQLVYKDYPVPTPKPNELLIHVKYSGVCHTDLHARKGDWPLATKLPLVGGHEGAGVVVGMGENVKGWKIGDFAGIKWLNGSCMSCEFCQQGAEPNCGEADLSGYTHDGSFEQYATADAVQAAKIPAGTDLANVAPILCAGVTVYKALKTADLAAGQWVAISGAGGGLGSLAVQYARAMGLRVVAIDGGDEKGEFVKSLGAEAYVDFTKDKDIVEAVKKATDGGPHGAINVSVSEKAIDQSVEYVRPLGKVVLVGLPAHAKVTAPVFDAVVKSIEIKGSYVGNRKDTAEAIDFFSRGLIKCPIKIVGLSDLPEVFKLMEEGKILGRYVLDTSK |
| Structure Information |
| PDB ID | Closest homologue in PDB is from S. cerevisiae with 73% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1--6 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Alcohol dehydrogenase (ADH1), enzyme
An alcohol + NAD+ => an aldehyde or ketone + NADH.
|
| References for function | |
| E.C. number | EC=1.1.1.1
|
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen from humans |
| References for function | PMID: 12622818 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |