| General Information |
| MoonProt ID | 1384 |
| First appeared in release | 4.0 |
| Name(s) | CLIC4, Chloride intracellular channel protein 4 |
| UniProt ID | Q9Y696 |
| GO terms | "GO:0001525 angiogenesis; GO:0001886 endothelial cell morphogenesis; GO:0007035 vacuolar acidification; GO:0009566 fertilization; GO:0035264 multicellular organism growth; GO:0048754 branching morphogenesis of an epithelial tube; GO:0061299 retina vasculature morphogenesis in camera-type eye; GO:0015630 microtubule cytoskeleton; GO:0005254 chloride channel activity; GO:0005515 protein binding; GO:0016491 oxidoreductase activity; GO:0006811 monoatomic ion transport; GO:0006821 chloride transport; GO:0030154 cell differentiation; GO:0030216 keratinocyte differentiation; " |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 253 |
| FASTA sequence | ">sp|Q9Y696|CLIC4_HUMAN Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLK
RKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMD
IFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLD
GNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEV
EIAYSDVAKRLTK" |
| Structure Information |
| PDB ID | 2AHE, 2D2Z, 3OQS |
| Quaternary structure | component of multiprotein transmembrane complex |
| SCOP | "80271771Q1S C
80395561Q1S C" |
| CATH | 2aheA01, 2aheA02 |
| TM Helix Prediction | NA |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | 606536 |
| Function 1 |
| Function description | ion channel |
| References for function | Alghalayini A, Hossain KR, Moghaddasi S, Turkewitz DR, D'Amario C, Wallach M, Valenzuela SM. In Vitro Enzymatic Studies Reveal pH and Temperature Sensitive Properties of the CLIC Proteins. Biomolecules. 2023 Sep 15;13(9):1394. doi: 10.3390/biom13091394. PMID: 37759794; PMCID: PMC10526857. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | membrane |
| Comments | |
| Function 2 |
| Function description | enzyme, glutaredoxin-like oxidoreductase |
| References for function | Alghalayini A, Hossain KR, Moghaddasi S, Turkewitz DR, D'Amario C, Wallach M, Valenzuela SM. In Vitro Enzymatic Studies Reveal pH and Temperature Sensitive Properties of the CLIC Proteins. Biomolecules. 2023 Sep 15;13(9):1394. doi: 10.3390/biom13091394. PMID: 37759794; PMCID: PMC10526857. |
| E.C. number | EC:1.8.-.- |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |