Protein Information

General Information
MoonProt ID149
First appeared in release1.0
Name(s)Ag85A antigen 85 (Ag85) complex FbpA protein Gene Name: fbpA
UniProt IDP9WQP3
GO terms
Organisms for which functions have been demonstratedMycobacterium tuberculosis
Sequence length338 aa
FASTA sequence>sp|P9WQP3|A85A_MYCTU Diacylglycerol acyltransferase/mycolyltransferase Ag85A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fbpA PE=1 SV=1 MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionmycolyltransferase, enzyme cell wall assembly Transesterification of mycolic acids
References for functionBelisle JT, Vissa VD, Sievert T, Takayama K, Brennan PJ, Besra GS. Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science. 1997 May 30. PMID: 9162010
E.C. number
Location of functional site(s)
Cellular location of functionsecreted
Comments
Function 2
Function descriptionfibronectin-binding
References for functionWiker HG, Sletten K, Nagai S, Harboe M. Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex. Infect Immun. 1990 Jan. PMID: 2403534
E.C. numberN/A
Location of functional site(s)
Cellular location of functionsecreted
Comments