| General Information |
| MoonProt ID | 151 |
| First appeared in release | 1.0 |
| Name(s) | folate receptor
FRalpha
Folate receptor alpha
FR-alpha
Folate receptor 1
Folate-binding protein 1
Gene Name:Folr1
|
| UniProt ID | P35846 (FOLR1_MOUSE), Reviewed |
| GO terms | GO:0006620 posttranslational protein targeting to membrane
GO:0006810 transport
GO:0015884 folic acid transport
GO:0046655 folic acid metabolic process
GO:0004872 receptor activity
GO:0005542 folic acid binding
GO:0008517 folic acid transporter activity
GO:0005576 extracellular region
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016023 cytoplasmic membrane-bounded vesicle
GO:0016324 apical plasma membrane
GO:0030136 clathrin-coated vesicle
GO:0031225 anchored component of membrane
GO:0031362 anchored component of external side of plasma membrane GO:0031410 cytoplasmic vesicle |
| Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
| Sequence length | 255 |
| FASTA sequence | >gi|357527376|ref|NP_001239483.1| folate receptor alpha precursor [Mus musculus]
MAHLMTVQLLLLVMWMAECAQSRATRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGFHGTWPLLCSLSLVLLWVIS |
| Structure Information |
| PDB ID | Closest homologue in PDB is from Homo Sapiens with 84.47% amino acid sequence identity; 80% query cover |
| Quaternary structure | |
| SCOP | TIM beta/alpha-barrel |
| CATH | 3.20.20.80 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1), and middle region (aa 47-50) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | folate receptor
binds folate and derivatives and brings them into the cell during endocytosis
|
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface, endocytic vesicles |
| Comments | |
| Function 2 |
| Function description | transcription factor
|
| References for function | Boshnjaku V, Shim KW, Tsurubuchi T, Ichi S, Szany EV, Xi G, ManiaFarnell B, McLone DG, Tomita T, Mayanil CS. Nuclear localization of folate receptor alpha: a new role as a transcription factor. Sci Rep. 2012 0. PMID: 23243496 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |