| General Information |
| MoonProt ID | 153 |
| First appeared in release | 1.0 |
| Name(s) | Aaa autolysin
N-acetylmuramoyl-L-alanine amidase sle1
Gene Name: sle1
|
| UniProt ID | Q2YVT4 (SLE1_STAAB) Reviewed |
| GO terms | GO:0000917 barrier septum assembly
GO:0007049 cell cycle
GO:0008152 metabolic process
GO:0009405 pathogenesis
GO:0016998 cell wall macromolecule catabolic process
GO:0019835 cytolysis
GO:0042742 defense response to bacterium
GO:0051301 cell division
GO:0003824 catalytic activity
GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
GO:0016787 hydrolase activity
GO:0005576 extracellular region
GO:0009986 cell surface |
| Organisms for which functions have been demonstrated | Staphylococcus aureus (Gram positive bacterium) |
| Sequence length | 334 |
| FASTA sequence | >gi|447092998|ref|WP_001170254.1| N-acetylmuramoyl-L-alanine amidase [Staphylococcus aureus]
MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYGISIAKLKSLNNLTSNLIFPNQVLKVSGSSNSTINSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQNIMRLNGLNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQKIMSLNGLNNFFIYPGQKLKVTGNATSSNSASATTTNRGYNTPVFSHQNLYTWGQCTYHVFNRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIAQTDVGYYGHVMFVERVNNDGSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH
|
| Structure Information |
| PDB ID | Closest homologue in PDB is from Staphylococcus saprophyticus with 50.47% amino acid sequence identity; 31% query cover |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Aaa autolysin
peptidoglycan hydrolase, enzyme
in cell division, cell separation, and cell wall turnover
also bacteriolytic activity
cleaves some cell wall glycopeptides, hydrolyzes the link between L-amino acid residues and N-acetylmuramoyl residues |
| References for function | Heilmann C, Thumm G, Chhatwal GS, Hartleib J, Uek?tter A, Peters G. Identification and characterization of a novel autolysin (Aae) with adhesive properties from Staphylococcus epidermidis. Microbiology. 2003 Oct. PMID: 14523110 |
| E.C. number | 3.5.1.28 |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |
| Function 2 |
| Function description | fibronectin binding, adhesin |
| References for function | Heilmann C, Hartleib J, Hussain MS, Peters G. The multifunctional Staphylococcus aureus autolysin aaa mediates adherence to immobilized fibrinogen and fibronectin. Infect Immun. 2005 Aug. PMID: 16040992
Heilmann C, Thumm G, Chhatwal GS, Hartleib J, Uek?tter A, Peters G. Identification and characterization of a novel autolysin (Aae) with adhesive properties from Staphylococcus epidermidis. Microbiology. 2003 Oct. PMID: 14523110 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | secreted |
| Comments | |