| General Information |
| MoonProt ID | 157 |
| First appeared in release | 1.0 |
| Name(s) | Ag85B
antigen 85 (Ag85) complex
FbpB protein
Gene Name: fbpB |
| UniProt ID | P9WQP1 |
| GO terms | |
| Organisms for which functions have been demonstrated | Mycobacterium tuberculosis (mycobacterium, causes tuberculosis) |
| Sequence length | |
| FASTA sequence | >sp|P9WQP1|A85B_MYCTU Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fbpB PE=1 SV=1
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
|
| Structure Information |
| PDB ID | 1F0N |
| Quaternary structure | |
| SCOP | alpha/beta-Hydrolases |
| CATH | 3.40.50.1820 |
| TM Helix Prediction | (20-42) signal peptide |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 10, 323-325 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | mycolyltransferase, enzyme
cell wall assembly
Transesterification of mycolic acids |
| References for function | Belisle JT, Vissa VD, Sievert T, Takayama K, Brennan PJ, Besra GS. Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science. 1997 May 30. PMID: 9162010 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | secreted |
| Comments | |
| Function 2 |
| Function description | fibronectin binding |
| References for function | Wiker HG, Sletten K, Nagai S, Harboe M. Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex. Infect Immun. 1990 Jan. PMID: 2403534 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | secreted |
| Comments | |