General Information |
MoonProt ID | 158 |
First appeared in release | 1.0 |
Name(s) | Ag85C
antigen 85 (Ag85) complex
FbpC protein
Gene Name: fbpC |
UniProt ID | P9WQN9 |
GO terms | |
Organisms for which functions have been demonstrated | Mycobacterium tuberculosis (mycobacterium, causes tuberculosis) |
Sequence length | 340 aa |
FASTA sequence | >sp|P9WQN9|A85C_MYCTU Diacylglycerol acyltransferase/mycolyltransferase Ag85C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fbpC PE=1 SV=1
MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
|
Structure Information |
PDB ID | 4MQM, 4QEK, 3HRH, 1VA5, 4QDZ, 4MQL, 4QE3, 4QDT, 4QDO, 4QDX, 1DQY, 1DQZ |
Quaternary structure | |
SCOP | alpha/beta-Hydrolases |
CATH | 3.40.50.1820 |
TM Helix Prediction | (21-43) signal peptide |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1 to 14, 328-340 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | mycolyltransferase, enzyme
cell wall assembly
Transesterification of mycolic acids |
References for function | Belisle JT, Vissa VD, Sievert T, Takayama K, Brennan PJ, Besra GS. Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science. 1997 May 30. PMID: 9162010 |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | secreted |
Comments | |
Function 2 |
Function description | fibronectin binding |
References for function | Wiker HG, Sletten K, Nagai S, Harboe M. Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex. Infect Immun. 1990 Jan. PMID: 2403534 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | secreted |
Comments | |