| General Information |
| MoonProt ID | 16 |
| First appeared in release | 1.0 |
| Name(s) | aspartate ammonia lyase
aspartase
Gene Name: aspA |
| UniProt ID | P44324 (ASPA_HAEIN), Reviewed |
| GO terms | GO:0006099 tricarboxylic acid cycle
GO:0006531 aspartate metabolic process
GO:0003824 catalytic activity
GO:0008797 aspartate ammonia-lyase activity
GO:0016829 lyase activity |
| Organisms for which functions have been demonstrated | Haemophilus influenzae (Gram negative bacterium) |
| Sequence length | 475 |
| FASTA sequence | >gi|1168534|sp|P44324.1|ASPA_HAEIN RecName: Full=Aspartate ammonia-lyase; Short=Aspartase
MITMTQFRKEVDLLGERDVPAEAYWGIHTLRAVENFNISNVTISDVPEFVRGMVMVKKATALANGELGAIPSDIAKAIVAACDEILTTGKCLDQFPSDVYQGGAGTSVNMNTNEVVANLALEKIGHKKGEYNVINPMDHVNASQSTNDAYPTGFRIAVYNSILKLIDKIQYLHDSFDNKAKEFANILKMGRTQLQDAVPMTVGQEFKAFAVLLEEEVRNLKRTAGLLLEVNLGATAIGTGLNTPQGYTELVVKHLAEVTGLACVPAENLIEATSDCGAYVMVHGALKRTAVKLSKVCNDLRLLSSGPRAGLKEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVTFASEAGQLQLNVMEPVIGQAMFESIDILTNACVNLRDKCVDGITVNKEICENYVFNSIGIVTYLNPFIGHHNGDLVGKICAQTGKGVREVVLEKGLLTEEQLDDILSVENLMNPTYKAKLNK |
| Structure Information |
| PDB ID | Closest homologue is 1JSW_A with 78.54% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1--7,469-475 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | aspartate ammonia lyase, aspartase, enzyme
L-aspartate => fumarate + NH3 |
| References for function | Demonstrated aspartase activity of purified protein: Sjstrm I, Grndahl H, Falk G, Kronvall G, Ullberg M.Biochim Biophys Acta. 1997 Purification and characterisation of a plasminogen-binding protein from Haemophilus influenzae. Sequence determination reveals identity with aspartase. Mar 13;1324(2):182-90.
PMID: 9092705 |
| E.C. number | 4.3.1.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Demonstrated aspartase activity of purified protein: Sjstrm I, Grndahl H, Falk G, Kronvall G, Ullberg M.Biochim Biophys Acta. 1997 Purification and characterisation of a plasminogen-binding protein from Haemophilus influenzae. Sequence determination reveals identity with aspartase. Mar 13;1324(2):182-90.
PMID: 9092705 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |