Protein Information

General Information
MoonProt ID160
First appeared in release1.0
Name(s)Lymphotactin Lymphotaxin ATAC C motif chemokine 1 Cytokine SCM-1 SCM-1-alpha Small-inducible cytokine C1 XC chemokine ligand 1 Gene Name:XCL1
UniProt IDP47992 (XCL1_HUMAN), Reviewed
GO termsGO:0001916 positive regulation of T cell mediated cytotoxicity GO:0002690 positive regulation of leukocyte chemotaxis GO:0002725 negative regulation of T cell cytokine production GO:0002726 positive regulation of T cell cytokine production GO:0002826 negative regulation of T-helper 1 type immune response GO:0006935 chemotaxis GO:0006955 immune response GO:0007165 signal transduction GO:0007267 cell-cell signaling GO:0009615 response to virus GO:0010820 positive regulation of T cell chemotaxis GO:0030593 neutrophil chemotaxis GO:0032689 negative regulation of interferon-gamma production GO:0032703 negative regulation of interleukin-2 production GO:0032733 positive regulation of interleukin-10 production GO:0035782 mature natural killer cell chemotaxis GO:0043433 negative regulation of sequence-specific DNA binding transcription factor activity GO:0045892 negative regulation of transcription, DNA-templated GO:0050727 regulation of inflammatory response GO:0051209 release of sequestered calcium ion into cytosol GO:0051281 positive regulation of release of sequestered calcium ion into cytosol GO:0071353 cellular response to interleukin-4 GO:0071560 cellular response to transforming growth factor beta stimulus GO:0071636 positive regulation of transforming growth factor beta production GO:0071663 positive regulation of granzyme B production GO:0090023 positive regulation of neutrophil chemotaxis GO:2000412 positive regulation of thymocyte migration GO:2000503 positive regulation of natural killer cell chemotaxis GO:2000513 positive regulation of granzyme A production GO:2000518 negative regulation of T-helper 1 cell activation GO:2000538 positive regulation of B cell chemotaxis GO:2000553 positive regulation of T-helper 2 cell cytokine production GO:2000556 positive regulation of T-helper 1 cell cytokine production GO:2000558 positive regulation of immunoglobulin production in mucosal tissue GO:2000562 negative regulation of CD4-positive, alpha-beta T cell proliferation GO:2000563 positive regulation of CD4-positive, alpha-beta T cell proliferation GO:2000566 positive regulation of CD8-positive, alpha-beta T cell proliferation GO:0005125 cytokine activity GO:0008009 chemokine activity GO:0042379 chemokine receptor binding GO:0042803 protein homodimerization activity GO:0005576 extracellular region GO:0005615 extracellular space
Organisms for which functions have been demonstratedHomo sapiens (human, a mammal, OMIM number 600250 )
Sequence length114
FASTA sequence>gi|1346471|sp|P47992.1|XCL1_HUMAN RecName: Full=Lymphotactin; AltName: Full=ATAC; AltName: Full=C motif chemokine 1; AltName: Full=Cytokine SCM-1; AltName: Full=Lymphotaxin; AltName: Full=SCM-1-alpha; AltName: Full=Small-inducible cytokine C1; AltName: Full=XC chemokine ligand 1; Flags: Precursor MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Structure Information
PDB ID4MQM, 4QEK, 3HRH, 1VA5, 4QDZ, 4MQL, 4QE3, 4QDT, 4QDO, 4QDX, 1DQY, 1DQZ
Quaternary structure
SCOPalpha/beta-Hydrolases
CATH3.40.50.1820
TM Helix Predictionno TM helices
DisProt AnnotationNot in DisProt
Predicted Disorder RegionsPredicted disorder at C terminus (aa 85-114)
Connections to Disease
OMIM ID
Function 1
Function descriptioncytokine agonist for XCR1, the specific G-protein-coupled receptor for lymphotactin
References for functionKelner GS, Kennedy J, Bacon KB, Kleyensteuber S, Largaespada DA, Jenkins NA, Copeland NG, Bazan JF, Moore KW, Schall TJ, et al. Lymphotactin: a cytokine that represents a new class of chemokine. Science. 1994 Nov 25. PMID: 7973732
E.C. numberN/A
Location of functional site(s)
Cellular location of functionsecreted
Comments
Function 2
Function descriptionbinding to cell-surface glycosaminoglycans **a Metamorphic protein - different fold than when cytokine***
References for functionPeterson FC, Elgin ES, Nelson TJ, Zhang F, Hoeger TJ, Linhardt RJ, Volkman BF. Identification and characterization of a glycosaminoglycan recognition element of the C chemokine lymphotactin. J Biol Chem. 2004 Mar 26. PMID: 14707146
E.C. numberN/A
Location of functional site(s)
Cellular location of functionsecreted
Comments