| General Information |
| MoonProt ID | 160 |
| First appeared in release | 1.0 |
| Name(s) | Lymphotactin
Lymphotaxin
ATAC
C motif chemokine 1
Cytokine SCM-1
SCM-1-alpha
Small-inducible cytokine C1
XC chemokine ligand 1
Gene Name:XCL1 |
| UniProt ID | P47992 (XCL1_HUMAN), Reviewed |
| GO terms | GO:0001916 positive regulation of T cell mediated cytotoxicity GO:0002690 positive regulation of leukocyte chemotaxis
GO:0002725 negative regulation of T cell cytokine production
GO:0002726 positive regulation of T cell cytokine production GO:0002826 negative regulation of T-helper 1 type immune response
GO:0006935 chemotaxis
GO:0006955 immune response
GO:0007165 signal transduction
GO:0007267 cell-cell signaling
GO:0009615 response to virus
GO:0010820 positive regulation of T cell chemotaxis
GO:0030593 neutrophil chemotaxis
GO:0032689 negative regulation of interferon-gamma production
GO:0032703 negative regulation of interleukin-2 production GO:0032733 positive regulation of interleukin-10 production GO:0035782 mature natural killer cell chemotaxis
GO:0043433 negative regulation of sequence-specific DNA binding transcription factor activity
GO:0045892 negative regulation of transcription, DNA-templated GO:0050727 regulation of inflammatory response
GO:0051209 release of sequestered calcium ion into cytosol
GO:0051281 positive regulation of release of sequestered calcium ion into cytosol
GO:0071353 cellular response to interleukin-4
GO:0071560 cellular response to transforming growth factor beta stimulus
GO:0071636 positive regulation of transforming growth factor beta production
GO:0071663 positive regulation of granzyme B production
GO:0090023 positive regulation of neutrophil chemotaxis
GO:2000412 positive regulation of thymocyte migration
GO:2000503 positive regulation of natural killer cell chemotaxis GO:2000513 positive regulation of granzyme A production
GO:2000518 negative regulation of T-helper 1 cell activation GO:2000538 positive regulation of B cell chemotaxis
GO:2000553 positive regulation of T-helper 2 cell cytokine production
GO:2000556 positive regulation of T-helper 1 cell cytokine production
GO:2000558 positive regulation of immunoglobulin production in mucosal tissue
GO:2000562 negative regulation of CD4-positive, alpha-beta T cell proliferation
GO:2000563 positive regulation of CD4-positive, alpha-beta T cell proliferation
GO:2000566 positive regulation of CD8-positive, alpha-beta T cell proliferation
GO:0005125 cytokine activity
GO:0008009 chemokine activity
GO:0042379 chemokine receptor binding
GO:0042803 protein homodimerization activity
GO:0005576 extracellular region
GO:0005615 extracellular space |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal, OMIM number 600250 ) |
| Sequence length | 114 |
| FASTA sequence | >gi|1346471|sp|P47992.1|XCL1_HUMAN RecName: Full=Lymphotactin; AltName: Full=ATAC; AltName: Full=C motif chemokine 1; AltName: Full=Cytokine SCM-1; AltName: Full=Lymphotaxin; AltName: Full=SCM-1-alpha; AltName: Full=Small-inducible cytokine C1; AltName: Full=XC chemokine ligand 1; Flags: Precursor
MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
|
| Structure Information |
| PDB ID | 4MQM, 4QEK, 3HRH, 1VA5, 4QDZ, 4MQL, 4QE3, 4QDT, 4QDO, 4QDX, 1DQY, 1DQZ |
| Quaternary structure | |
| SCOP | alpha/beta-Hydrolases |
| CATH | 3.40.50.1820 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 2, 90-114 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | cytokine
agonist for XCR1, the specific G-protein-coupled receptor for lymphotactin |
| References for function | Kelner GS, Kennedy J, Bacon KB, Kleyensteuber S, Largaespada DA, Jenkins NA, Copeland NG, Bazan JF, Moore KW, Schall TJ, et al. Lymphotactin: a cytokine that represents a new class of chemokine. Science. 1994 Nov 25. PMID: 7973732 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | secreted |
| Comments | |
| Function 2 |
| Function description | binding to cell-surface glycosaminoglycans
**a Metamorphic protein - different fold than when cytokine*** |
| References for function | Peterson FC, Elgin ES, Nelson TJ, Zhang F, Hoeger TJ, Linhardt RJ, Volkman BF. Identification and characterization of a glycosaminoglycan recognition element of the C chemokine lymphotactin. J Biol Chem. 2004 Mar 26. PMID: 14707146 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | secreted |
| Comments | |