| General Information |
| MoonProt ID | 164 |
| First appeared in release | 1.0 |
| Name(s) | Glutamate dehydrogenase
RocG
Catabolic NAD-specific glutamate dehydrogenase RocG
NAD-GDH
GlutDH
Trigger enzyme RocG
Gene Name:rocG |
| UniProt ID | P39633 (DHE2_BACSU) Reviewed |
| GO terms | GO:0006520 cellular amino acid metabolic process
GO:0055114 oxidation-reduction process
GO:0004352 glutamate dehydrogenase (NAD+) activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016639 oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor |
| Organisms for which functions have been demonstrated | Bacillus subtilis |
| Sequence length | 424 |
| FASTA sequence | >gi|349596655|gb|AEP92842.1| glutamate dehydrogenase [Bacillus subtilis subsp. subtilis str. RO-NN-1]
MSAKQVSKDEEKEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEEVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLFTDVITNEELLEKECDILVPAAISNQITAKNAHNIQASIVVEAANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGIRKSAEASRFRGWV
|
| Structure Information |
| PDB ID | 3K92 |
| Quaternary structure | |
| SCOP | NAD(P)-binding Rossmann-fold domains, Aminoacid dehydrogenase-like, N-terminal domain |
| CATH | 1.10.8.1210, 3.40.50.10860, 3.40.50.720 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 14 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glutamate dehydrogenase
deaminates glutamate to form ?-ketoglutarate
L-glutamate + H2O + NAD+ => 2-oxoglutarate + NH3 + NADH. |
| References for function | Gunka K, Newman JA, Commichau FM, Herzberg C, Rodrigues C, Hewitt L, Lewis RJ, St?lke J. Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties. J Mol Biol. 2010 Jul 23. PMID: 20630473 |
| E.C. number | 1.4.1.2 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | interacts directly with GltC, a LysR-type transcription factor |
| References for function | Gunka K, Newman JA, Commichau FM, Herzberg C, Rodrigues C, Hewitt L, Lewis RJ, St?lke J. Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties. J Mol Biol. 2010 Jul 23. PMID: 20630473 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | near DNA |
| Comments | |