| General Information |
| MoonProt ID | 166 |
| First appeared in release | 1.0 |
| Name(s) | Arg82
Inositol polyphosphate multikinase
IPMK
Ipk2
Arginine metabolism regulation protein III
Gene Name:ARG82 |
| UniProt ID | P07250 (IPMK_YEAST), Reviewed |
| GO terms | GO:0000122 negative regulation of transcription from RNA polymerase II promoter
GO:0000821 regulation of arginine metabolic process
GO:0006351 transcription, DNA-templated
GO:0006355 regulation of transcription, DNA-templated
GO:0006525 arginine metabolic process
GO:0016310 phosphorylation
GO:0032958 inositol phosphate biosynthetic process
GO:0045944 positive regulation of transcription from RNA polymerase II promoter
GO:0046854 phosphatidylinositol phosphorylation
GO:0050821 protein stabilization
GO:0000166 nucleotide binding
GO:0000823 inositol-1,4,5-trisphosphate 6-kinase activity GO:0000824 inositol tetrakisphosphate 3-kinase activity
GO:0000825 inositol tetrakisphosphate 6-kinase activity
GO:0000827 inositol-1,3,4,5,6-pentakisphosphate kinase activity GO:0005524 ATP binding
GO:0008440 inositol-1,4,5-trisphosphate 3-kinase activity GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0030674 protein binding, bridging
GO:0035004 phosphatidylinositol 3-kinase activity
GO:0046872 metal ion binding
GO:0005634 nucleus |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 355 |
| FASTA sequence | >sp|P07250|IPMK_YEAST Inositol polyphosphate multikinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG82 PE=1 SV=1
MDTVNNYRVLEHKAAGHDGTLTDGDGLLIFKPAFPQELEFYKAIQVRDVSRRKSSADGDAPLCSWMPTYLGVLNEGAKIEQSGDAALLKIDERLSDSTDNLDSIPVKSEKSKQYLVLENLLYGFSKPNILDIKLGKTLYDSKASLEKRERMKRVSETTTSGSLGFRICGMKIQKNPSVLNQLSLEYYEEEADSDYIFINKLYGRSRTDQNVSDAIELYFNNPHLSDARKHQLKKTFLKRLQLFYNTMLEEEVRMISSSLLFIYEGDPERWELLNDVDKLMRDDFIDDDDDDDDNDDDDDDDAEGSSEGPKDKKTTGSLSSMSLIDFAHSEITPGKGYDENVIEGVETLLDIFMKF
|
| Structure Information |
| PDB ID | 2IEW,
2IF8 |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.30.470.160 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 6, 81-105, 283-313 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | kinase, enzyme
phosphorylates inositol 1,4,5-trisphosphate (Ins(1,4,5)P3) and inositol 1,3,4,5-tetrakisphosphate (Ins(1,3,4,5)P4)
2 ATP + 1D-myo-inositol 1,4,5-trisphosphate => 2 ADP + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate.
|
| References for function | Holmes W, Jogl G. Crystal structure of inositol phosphate multikinase 2 and implications for substrate specificity. J Biol Chem. 2006 Dec 8. PMID: 17050532.
Saiardi A, ErdjumentBromage H, Snowman AM, Tempst P, Snyder SH. Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases. Curr Biol. 1999 Nov 18. PMID: 10574768.
Odom AR, Stahlberg A, Wente SR, York JD. A role for nuclear inositol 1,4,5-trisphosphate kinase in transcriptional control. Science. 2000 Mar 17. PMID: 10720331. |
| E.C. number | 2.7.1.151 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm? |
| Comments | |
| Function 2 |
| Function description | stabilizes transcription factors ARG80 and MCM1 |
| References for function | El Bakkoury, Dubois E, Messenguy F. Recruitment of the yeast MADS-box proteins, ArgRI and Mcm1 by the pleiotropic factor ArgRIII is required for their stability. Mol Microbiol. 2000 Jan. PMID: 10632874. |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |