| General Information |
| MoonProt ID | 168 |
| First appeared in release | 1.0 |
| Name(s) | Syntaxin-2
Epimorphin
Gene Name:STX2 |
| UniProt ID | P32856 (STX2_HUMAN), Reviewed |
| GO terms | GO:0006886 intracellular protein transport
GO:0007165 signal transduction
GO:0007340 acrosome reaction
GO:0007398 ectoderm development
GO:0009887 organ morphogenesis
GO:0016192 vesicle-mediated transport
GO:0030154 cell differentiation
GO:0005484 SNAP receptor activity
GO:0005515 protein binding
GO:0048306 calcium-dependent protein binding
GO:0005911 cell-cell junction
GO:0009986 cell surface
GO:0016020 membrane
GO:0016021 integral component of membrane
GO:0016323 basolateral plasma membrane
GO:0031410 cytoplasmic vesicle
GO:0043231 intracellular membrane-bounded organelle
GO:0045121 membrane raft |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal, OMIM number 132350 ) |
| Sequence length | 288 |
| FASTA sequence | >sp|P32856|STX2_HUMAN Syntaxin-2 OS=Homo sapiens GN=STX2 PE=1 SV=3
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
|
| Structure Information |
| PDB ID | Closest homologue in PDB is from Rattus norvegicus with 69.42% amino acid sequence identity; 84% query cover |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | 1(265-287) type IV transmembrane protein |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 17, 60-70, 97-110, 152-167, 285-288 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | epimorphin - mediates epithelial tissue morphogenesis outside the cell
|
| References for function | Hirai, Y., Bissell, M. J. & Radisky, D. C. Extracellular localization of epimorphin/syntaxin?2. Blood 110, 3082 (2007). PMID: 17916751 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | extracellular cell surface and secreted |
| Comments | |
| Function 2 |
| Function description | syntaxin 2
controls protein secretion from endoplasmic reticulumGolgi-derived vesicles
it is a target SNARE (t-SNARE) on the cytoplasmic side of the plasma membranes that aids in fusion of the plasma membrane with vesicles that carry the appropriate vesicle SNARE (v-SNARE) proteins |
| References for function | Jahn R, Scheller RH. SNAREs: engines for membrane fusion. Nat Rev Mol Cell Biol (2006) 7:631-643. 16912714 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | intracellular surface of plasma membrane |
| Comments | |