| General Information |
| MoonProt ID | 170 |
| First appeared in release | 1.0 |
| Name(s) | Extracellular signal-regulated kinase 2
ERK-2
MAP kinase isoform p42
p42-MAPK
Mitogen-activated protein kinase 2
MAP kinase 2
MAPK 2
Gene Name: MAPK1 |
| UniProt ID | P28482 (MK01_HUMAN), Reviewed |
| GO terms | GO:0000165 MAPK cascade
GO:0000186 activation of MAPKK activity
GO:0000187 activation of MAPK activity
GO:0000189 MAPK import into nucleus
GO:0002224 toll-like receptor signaling pathway
GO:0002755 MyD88-dependent toll-like receptor signaling pathway GO:0002756 MyD88-independent toll-like receptor signaling pathway GO:0006351 transcription, DNA-templated
GO:0006355 regulation of transcription, DNA-templated
GO:0006468 protein phosphorylation
GO:0006915 apoptotic process
GO:0006935 chemotaxis
GO:0006950 response to stress
GO:0006974 cellular response to DNA damage stimulus
GO:0007049 cell cycle
GO:0007165 signal transduction
GO:0007173 epidermal growth factor receptor signaling pathway GO:0007264 small GTPase mediated signal transduction
GO:0007265 Ras protein signal transduction
GO:0007268 synaptic transmission
GO:0007411 axon guidance
GO:0007596 blood coagulation
GO:0008284 positive regulation of cell proliferation
GO:0008286 insulin receptor signaling pathway
GO:0008543 fibroblast growth factor receptor signaling pathway GO:0009636 response to toxic substance
GO:0009887 organ morphogenesis
GO:0010800 positive regulation of peptidyl-threonine phosphorylation
GO:0016032 viral process
GO:0016310 phosphorylation
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0018107 peptidyl-threonine phosphorylation
GO:0019233 sensory perception of pain
GO:0019858 cytosine metabolic process
GO:0030168 platelet activation
GO:0030335 positive regulation of cell migration
GO:0031647 regulation of protein stability
GO:0031663 lipopolysaccharide-mediated signaling pathway
GO:0032496 response to lipopolysaccharide
GO:0032872 regulation of stress-activated MAPK cascade
GO:0033598 mammary gland epithelial cell proliferation
GO:0034134 toll-like receptor 2 signaling pathway
GO:0034138 toll-like receptor 3 signaling pathway
GO:0034142 toll-like receptor 4 signaling pathway
GO:0034146 toll-like receptor 5 signaling pathway
GO:0034162 toll-like receptor 9 signaling pathway
GO:0034166 toll-like receptor 10 signaling pathway
GO:0035556 intracellular signal transduction
GO:0035666 TRIF-dependent toll-like receptor signaling pathway GO:0038095 Fc-epsilon receptor signaling pathway
GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
GO:0038123 toll-like receptor TLR1:TLR2 signaling pathway GO:0038127 ERBB signaling pathway
GO:0043330 response to exogenous dsRNA
GO:0043627 response to estrogen
GO:0045087 innate immune response
GO:0045596 negative regulation of cell differentiation
GO:0045727 positive regulation of translation
GO:0045893 positive regulation of transcription, DNA-templated
GO:0048011 neurotrophin TRK receptor signaling pathway
GO:0050852 T cell receptor signaling pathway
GO:0050853 B cell receptor signaling pathway
GO:0051090 regulation of sequence-specific DNA binding transcription factor activity
GO:0051403 stress-activated MAPK cascade
GO:0051493 regulation of cytoskeleton organization
GO:0060397 JAK-STAT cascade involved in growth hormone signaling pathway
GO:0060716 labyrinthine layer blood vessel development
GO:0070371 ERK1 and ERK2 cascade
GO:0070849 response to epidermal growth factor
GO:0072584 caveolin-mediated endocytosis
GO:0090170 regulation of Golgi inheritance
GO:2000641 regulation of early endosome to late endosome transport
GO:0000166 nucleotide binding
GO:0001784 phosphotyrosine binding
GO:0003677 DNA binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008134 transcription factor binding
GO:0008353 RNA polymerase II carboxy-terminal domain kinase activity
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0016772 transferase activity, transferring phosphorus-containing groups
GO:0019902 phosphatase binding
GO:0031435 mitogen-activated protein kinase kinase kinase binding
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005794 Golgi apparatus
GO:0005815 microtubule organizing center
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005901 caveola
GO:0005925 focal adhesion
GO:0015630 microtubule cytoskeleton
GO:0031143 pseudopodium
GO:0032839 dendrite cytoplasm
GO:0043204 perikaryon
GO:0043234 protein complex
GO:0072686 mitotic spindle
GO:0005730 nucleolus |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal, OMIM number 176948 ) |
| Sequence length | 360 |
| FASTA sequence | >sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
| Structure Information |
| PDB ID | 2Y9Q,
4FMQ,
4FV6,
1WZY,
3W55,
1TVO,
2OJG,
2OJI,
2OJJ,
3I5Z,
3I60,
4FV1, 4FV2, 4FV3, 4FV4, 4FV5, 4FV8, 4FV9, 4G6N, 3TEI, 4H3P, 4FV7, 4G6O, 3O71, 3C9W, 2Z7L, 2FYS, 1ERK, 3ERK, 4ERK, 3QYI,
4H3Q |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.30.200.20, 1.10.510.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 12, 356-360 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Erk2 kinase, enzyme
Serine/threonine kinase
ATP + a protein => ADP + a phosphoprotein. |
| References for function | |
| E.C. number | 2.7.11.24 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | transcriptional repressor
represses expression of interferon gamma-induced genes |
| References for function | Hu S1, Xie Z, Onishi A, Yu X, Jiang L, Lin J, Rho HS, Woodard C, Wang H, Jeong JS, Long S, He X, Wade H, Blackshaw S, Qian J, Zhu H.Profiling the human protein-DNA interactome reveals ERK2 as a transcriptional repressor of interferon signaling.Cell. 2009 Oct 30;139(3):610-22. doi: 10.1016/j.cell.2009.08.037.
PMID: 19879846
|
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |