| General Information |
| MoonProt ID | 174 |
| First appeared in release | 1.0 |
| Name(s) | 50S ribosomal protein L7
50S ribosomal protein L7Ae
Ribosomal protein L8e
Gene Name: rpl7ae |
| UniProt ID | P54066 (RL7A_METJA), Reviewed |
| GO terms | GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0005622 intracellular
GO:0005840 ribosome
GO:0030529 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Methanococcus jannaschii |
| Sequence length | 117 |
| FASTA sequence | >gi|56965936|pdb|1RA4|A Chain A, Crystal Structure Of The Methanococcus Jannaschii L7ae Protein
GSHMAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ
|
| Structure Information |
| PDB ID | 1RA4,
1XBI,
1SDS,
3PAF |
| Quaternary structure | |
| SCOP | Bacillus chorismate mutase-like |
| CATH | 3.30.1330.30 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-3), and C terminus (aa 116-117) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | part of the ribosome |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, part of ribosome |
| Comments | |
| Function 2 |
| Function description | sRNP core protein
binds the box C/D snoRNA core motif, homologue of eukaryotic 15.5kD protein |
| References for function | Kuhn JF, Tran EJ, Maxwell ES. Archaeal ribosomal protein L7 is a functional homolog of the eukaryotic 15.5kD/Snu13p snoRNP core protein. Nucleic Acids Res. 2002 Feb 15. PMID: 11842104 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |