| General Information |
| MoonProt ID | 176 |
| First appeared in release | 4.0 |
| Name(s) | Histone acetyltransferase KAT5 |
| UniProt ID | Q92993 |
| GO terms | "GO:0006357 regulation of transcription by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1905691 lipid droplet disassembly
GO:0003682 chromatin binding
GO:0003682 chromatin binding
GO:0003682 chromatin binding
GO:0003682 chromatin binding
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0003713 transcription coactivator activity
GO:0003713 transcription coactivator activity
GO:0004402 histone acetyltransferase activity
GO:0004402 histone acetyltransferase activity
GO:0004402 histone acetyltransferase activity
GO:0004402 histone acetyltransferase activity
GO:0004402 histone acetyltransferase activity
GO:0004402 histone acetyltransferase activity
GO:0004402 histone acetyltransferase activity
GO:0004402 histone acetyltransferase activity
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0010485 histone H4 acetyltransferase activity
GO:0016407 acetyltransferase activity
GO:0016407 acetyltransferase activity
GO:0016740 transferase activity
GO:0016746 acyltransferase activity
GO:0043998 histone H2A acetyltransferase activity
GO:0043998 histone H2A acetyltransferase activity
GO:0043998 histone H2A acetyltransferase activity
GO:0043999 histone H2AK5 acetyltransferase activity
GO:0046872 metal ion binding
GO:0046972 histone H4K16 acetyltransferase activity
GO:0046972 histone H4K16 acetyltransferase activity
GO:0046972 histone H4K16 acetyltransferase activity
GO:0046972 histone H4K16 acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0061733 protein-lysine-acetyltransferase activity
GO:0106226 peptide 2-hydroxyisobutyryltransferase activity
GO:0120300 peptide lactyltransferase (CoA-dependent) activity
GO:0120300 peptide lactyltransferase (CoA-dependent) activity
GO:0120300 peptide lactyltransferase (CoA-dependent) activity
GO:0140064 peptide crotonyltransferase activity
GO:0140064 peptide crotonyltransferase activity
GO:0140064 peptide crotonyltransferase activity
GO:0140065 peptide butyryltransferase activity
GO:0140297 DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000132 establishment of mitotic spindle orientation
GO:0000132 establishment of mitotic spindle orientation
GO:0000724 double-strand break repair via homologous recombination
GO:0000724 double-strand break repair via homologous recombination
GO:0000724 double-strand break repair via homologous recombination
GO:0000724 double-strand break repair via homologous recombination
GO:0002376 immune system process
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006302 double-strand break repair
GO:0006302 double-strand break repair
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0006974 DNA damage response
GO:0006974 DNA damage response
GO:0007286 spermatid development
GO:0007286 spermatid development
GO:0010212 response to ionizing radiation
GO:0010506 regulation of autophagy
GO:0010508 positive regulation of autophagy
GO:0010508 positive regulation of autophagy
GO:0010867 positive regulation of triglyceride biosynthetic process
GO:0010867 positive regulation of triglyceride biosynthetic process
GO:0018394 peptidyl-lysine acetylation
GO:0021915 neural tube development
GO:0022008 neurogenesis
GO:0030330 DNA damage response, signal transduction by p53 class mediator
GO:0032703 negative regulation of interleukin-2 production
GO:0033554 cellular response to stress
GO:0035092 sperm DNA condensation
GO:0042149 cellular response to glucose starvation
GO:0042149 cellular response to glucose starvation
GO:0042753 positive regulation of circadian rhythm
GO:0042753 positive regulation of circadian rhythm
GO:0042981 regulation of apoptotic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045087 innate immune response
GO:0045591 positive regulation of regulatory T cell differentiation
GO:0045591 positive regulation of regulatory T cell differentiation
GO:0045663 positive regulation of myoblast differentiation
GO:0045663 positive regulation of myoblast differentiation
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051726 regulation of cell cycle
GO:0062033 positive regulation of mitotic sister chromatid segregation
GO:0062033 positive regulation of mitotic sister chromatid segregation
GO:0071333 cellular response to glucose stimulus
GO:0071392 cellular response to estradiol stimulus
O:0090398 cellular senescence
GO:0140861 DNA repair-dependent chromatin remodeling
GO:0140861 DNA repair-dependent chromatin remodeling
GO:1901701 cellular response to oxygen-containing compound
GO:1901985 positive regulation of protein acetylation
GO:1902036 regulation of hematopoietic stem cell differentiation
GO:1902036 regulation of hematopoietic stem cell differentiation
GO:1902425 positive regulation of attachment of mitotic spindle microtubules to kinetochore
GO:1902425 positive regulation of attachment of mitotic spindle microtubules to kinetochore
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:1905337 positive regulation of aggrephagy
GO:2000042 negative regulation of double-strand break repair via homologous recombination
GO:2000779 regulation of double-strand break repair
GO:0000776 kinetochore
GO:0000785 chromatin
GO:0000785 chromatin
GO:0005634 nucleus
GO:0035861 site of double-strand break
GO:0097431 mitotic spindle pole
GO:0000776 kinetochore
GO:0000776 kinetochore
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031981 nuclear lumen
GO:0048471 perinuclear region of cytoplasm
GO:0097431 mitotic spindle pole
GO:0000123 histone acetyltransferase complex
GO:0000786 nucleosome
GO:0000812 Swr1 complex
GO:0005667 transcription regulator complex
GO:0032777 piccolo histone acetyltransferase complex
GO:0032777 piccolo histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 513.0 |
| FASTA sequence | >sp|Q92993|KAT5_HUMAN Histone acetyltransferase KAT5 OS=Homo sapiens OX=9606 GN=KAT5 PE=1 SV=2 MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAV AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW |
| Structure Information |
| PDB ID | 2EKO |
| Quaternary structure | Component of the NuA4 histone acetyltransferase complex |
| SCOP | NA |
| CATH | 2.30.30.140 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-5), middle region (aa 71-219), and C terminus (aa 508-513) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Component of p400/Tip60 chromatin remodeling complex |
| References for function | Messina G, Prozzillo Y, Monache FD, Santopietro MV, Dimitri P. Evolutionary conserved relocation of chromatin remodeling complexes to the mitotic apparatus. BMC Biol. 2022 Aug 3;20(1):172. doi: 10.1186/s12915-022-01365-5. PMID: 35922843; PMCID: PMC9351137. |
| E.C. number | EC:2.3.1.48 |
| Location of functional site(s) | |
| Cellular location of function | chromatin |
| Comments | |
| Function 2 |
| Function description | localizes to the mitotic spindle, kinetochore and midbody during cell division |
| References for function | Messina G, Prozzillo Y, Monache FD, Santopietro MV, Dimitri P. Evolutionary conserved relocation of chromatin remodeling complexes to the mitotic apparatus. BMC Biol. 2022 Aug 3;20(1):172. doi: 10.1186/s12915-022-01365-5. PMID: 35922843; PMCID: PMC9351137. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | mitotic apparatus |
| Comments | |