Protein Information

General Information
MoonProt ID178
First appeared in release1.0
Name(s)60S ribosomal protein L30 L32 RP73 YL38 RPL32 Gene Name: RPL30
UniProt IDP14120 (RL30_YEAST), Reviewed
GO termsGO:0002181 cytoplasmic translation GO:0006364 rRNA processing GO:0006412 translation GO:0017148 negative regulation of translation GO:0048025 negative regulation of mRNA splicing, via spliceosome GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0030627 pre-mRNA 5'-splice site binding GO:0005622 intracellular GO:0005737 cytoplasm GO:0005840 ribosome GO:0022625 cytosolic large ribosomal subunit GO:0030529 ribonucleoprotein complex
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length105
FASTA sequence>sp|P14120|RL30_YEAST 60S ribosomal protein L30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL30 PE=1 SV=3 MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Structure Information
PDB ID1T0K, 3IZS, 3O58, 3O5H, 3U5E, 3U5I, 4B6A, 1CK2, 1CN7, 1NMU, 4BYN, 4BYU, 3JYW
Quaternary structure
Function 1
Function descriptionComponent of the ribosome large subunit (60S)
References for function
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of the ribosome
Comments
Function 2
Function descriptioninhibits the splicing of the transcript of its own gene, RPL32
References for functionEng FJ, Warner JR. Structural basis for the regulation of splicing of a yeast messenger RNA. Cell. 1991 May 31. PMID: 2040015
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments