| General Information |
| MoonProt ID | 180 |
| First appeared in release | 1.0 |
| Name(s) | 60S ribosomal protein L2-A
L5
RP8
YL6
Gene Name:RPL2A
|
| UniProt ID | P0CX45 (RL2A_YEAST) Reviewed |
| GO terms | GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0005622 intracellular
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030529 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 254 |
| FASTA sequence | >sp|P0CX45|RL2A_YEAST 60S ribosomal protein L2-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL2A PE=1 SV=1
MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAKVVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLLKAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD
|
| Structure Information |
| PDB ID | 3IZS, 3O58, 3O5H, 3U5E, 3U5I, 4B6A, 1S1I, 4BYN, 4BYU, 3JYW, |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 2, 7-23, 213-229, 245-254 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Component of the ribosome large subunit (60S). |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | regulates accumulation of L2 mRNA, shortens half-life of L2 mRNA
|
| References for function | Presutti C, Ciafr? SA, Bozzoni I. The ribosomal protein L2 in S. cerevisiae controls the level of accumulation of its own mRNA. EMBO J. 1991 Aug. PMID: 2065661 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |