| General Information |
| MoonProt ID | 182 |
| First appeared in release | 1.0 |
| Name(s) | 60S ribosomal protein L12
Gene Name:rpl-12 |
| UniProt ID | P61866 (RL12_CAEEL), Reviewed |
| GO terms | GO:0006412 translation
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005840 ribosome
GO:0030529 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Caenorhabditis elegans (nematode, worm) |
| Sequence length | 165 |
| FASTA sequence | >sp|P61866|RL12_CAEEL 60S ribosomal protein L12 OS=Caenorhabditis elegans GN=rpl-12 PE=3 SV=1
MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKATQDWKGLKVTCKLTIQNRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVKHNGDLTVDTIIKIARIMRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEIPAQ
|
| Structure Information |
| PDB ID | Closest homologue in PDB is from Drosophila melanogaster with 74.55% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 4, 6, 86-98, 163-165 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ribosomal protein
Binds RNA directly (26S rRNA) |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, part of ribosome |
| Comments | |
| Function 2 |
| Function description | inhibits splicing of its own RNA |
| References for function | Mitrovich QM, Anderson P. Unproductively spliced ribosomal protein mRNAs are natural targets of mRNA surveillance in C. elegans. Genes Dev. 2000 Sep 1. PMID: 10970881 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |