| General Information |
| MoonProt ID | 192 |
| First appeared in release | 1.0 |
| Name(s) | 40S ribosomal protein S3
Gene Name:RpS3 |
| UniProt ID | Q06559 (RS3_DROME), Reviewed |
| GO terms | GO:0000737 DNA catabolic process, endonucleolytic
GO:0002181 cytoplasmic translation
GO:0006281 DNA repair
GO:0006412 translation
GO:0006974 cellular response to DNA damage stimulus
GO:0007067 mitosis
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0043524 negative regulation of neuron apoptotic process
GO:0090305 nucleic acid phosphodiester bond hydrolysis
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0003906 DNA-(apurinic or apyrimidinic site) lyase activity GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0016787 hydrolase activity
GO:0005622 intracellular
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0005875 microtubule associated complex
GO:0015935 small ribosomal subunit
GO:0016363 nuclear matrix
GO:0030529 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly, an insect) |
| Sequence length | 246 |
| FASTA sequence | >sp|Q06559|RS3_DROME 40S ribosomal protein S3 OS=Drosophila melanogaster GN=RpS3 PE=1 SV=1
MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL
|
| Structure Information |
| PDB ID | 3J38 |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 6, 218-246 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ribosomal protein, part of 40S subunit |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, part of ribosome |
| Comments | |
| Function 2 |
| Function description | DNA repair activity
cleaves DNA at apurinic/apyrimidinic sites
|
| References for function | Wilson DM, Deutsch WA, Kelley MR. Drosophila ribosomal protein S3 contains an activity that cleaves DNA at apurinic/apyrimidinic sites. J Biol Chem. 1994 Oct 14. PMID: 7929231 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |