Protein Information

General Information
MoonProt ID197
First appeared in release1.0
Name(s)Fructose-1,6-bisphosphate aldolase/phosphatase
UniProt IDB1YAL1
GO terms
Organisms for which functions have been demonstratedThermoproteus neutrophilus
Sequence length399 aa
FASTA sequence>sp|B1YAL1|FBPAP_PYRNV Fructose-1,6-bisphosphate aldolase/phosphatase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fbp PE=1 SV=1 MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTHTKGEDNKDIHGLAWETFKEVTDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEERPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDPSMHEGFIFEVLDVVEHKVYLLKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVRAQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPPKVGALGFQLHEGYLEGGVDLFDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTALPKILAKVKPYPADQYEKDRKKYIEAVVKGAKVEESQHD
Structure Information
PDB ID3T2B, 3T2D, 3T2E, 3T2F, 3T2G
Quaternary structure
Function 1
Function descriptionfructose-1,6-bisphosphatase, enzyme dephosphorylation of FBP to fructose-6-phosphate
References for functionDu J, Say RF, L? W, Fuchs G, Einsle O. Active-site remodelling in the bifunctional fructose-1,6-bisphosphate aldolase/phosphatase. Nature. 2011 Oct 9. PMID: 21983965
E.C. number3.1.3.11
Location of functional site(s)
Cellular location of functioncytoplasm
CommentsNote - both functions in same active site
Function 2
Function descriptionfructose-1,6-bisphosphate aldolase, enzyme reversible aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate (GA3P) to FBP
References for functionDu J, Say RF, L? W, Fuchs G, Einsle O. Active-site remodelling in the bifunctional fructose-1,6-bisphosphate aldolase/phosphatase. Nature. 2011 Oct 9. PMID: 21983965
E.C. number4.1.2.13
Location of functional site(s)
Cellular location of functioncytoplasm
CommentsNote - both functions in same active site