| General Information |
| MoonProt ID | 197 |
| First appeared in release | 1.0 |
| Name(s) | Fructose-1,6-bisphosphate aldolase/phosphatase |
| UniProt ID | B1YAL1 |
| GO terms | |
| Organisms for which functions have been demonstrated | Thermoproteus neutrophilus |
| Sequence length | 399 aa |
| FASTA sequence | >sp|B1YAL1|FBPAP_PYRNV Fructose-1,6-bisphosphate aldolase/phosphatase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fbp PE=1 SV=1
MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTHTKGEDNKDIHGLAWETFKEVTDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEERPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDPSMHEGFIFEVLDVVEHKVYLLKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVRAQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPPKVGALGFQLHEGYLEGGVDLFDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTALPKILAKVKPYPADQYEKDRKKYIEAVVKGAKVEESQHD
|
| Structure Information |
| PDB ID | 3T2B, 3T2D, 3T2E,
3T2F,
3T2G |
| Quaternary structure | |
| SCOP | Sulfolobus fructose-1,6-bisphosphatase-like |
| CATH | 6.10.250.1180 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-2, 349-352, 384-399 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | fructose-1,6-bisphosphatase, enzyme
dephosphorylation of FBP to fructose-6-phosphate |
| References for function | Du J, Say RF, L? W, Fuchs G, Einsle O. Active-site remodelling in the bifunctional fructose-1,6-bisphosphate aldolase/phosphatase. Nature. 2011 Oct 9. PMID: 21983965 |
| E.C. number | 3.1.3.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | Note - both functions in same active site |
| Function 2 |
| Function description | fructose-1,6-bisphosphate aldolase, enzyme
reversible aldol condensation of dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate (GA3P) to FBP |
| References for function | Du J, Say RF, L? W, Fuchs G, Einsle O. Active-site remodelling in the bifunctional fructose-1,6-bisphosphate aldolase/phosphatase. Nature. 2011 Oct 9. PMID: 21983965 |
| E.C. number | 4.1.2.13 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | Note - both functions in same active site |