| General Information |
| MoonProt ID | 204 |
| First appeared in release | 1.0 |
| Name(s) | Uridylate kinase
UMP kinase
UMPK
Uridine monophosphate kinase
Gene Name:pyrH |
| UniProt ID | P0A7E9 (PYRH_ECOLI), Reviewed |
| GO terms | GO:0006221 pyrimidine nucleotide biosynthetic process
GO:0008152 metabolic process
GO:0016310 phosphorylation
GO:0044210 'de novo' CTP biosynthetic process
GO:0046939 nucleotide phosphorylation
GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0005524 ATP binding
GO:0009041 uridylate kinase activity
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0033862 UMP kinase activity
GO:0042802 identical protein binding
GO:0005737 cytoplasm
GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Escherichia coli (Gram negative bacterium) |
| Sequence length | 241 |
| FASTA sequence | >sp|P0A7E9|PYRH_ECOLI Uridylate kinase OS=Escherichia coli (strain K12) GN=pyrH PE=1 SV=2
MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
|
| Structure Information |
| PDB ID | 2BNE
2V4Y
2BND
2BNF |
| Quaternary structure | |
| SCOP | Carbamate kinase-like |
| CATH | 3.40.1160.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-6, 238-241 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | UMP kinase, enzyme
phosphorylates UMP to UDP
ATP + UMP <=> ADP + UDP
de novo biosynthetic pathway of pyrimidine nucleotides |
| References for function | Bucurenci N, Serina L, Zaharia C, Landais S, Danchin A, B?rzu O. Mutational analysis of UMP kinase from Escherichia coli. J Bacteriol. 1998 Feb. PMID: 9457846 |
| E.C. number | 2.7.4.22 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | transcriptional regulator
involved in pyrimidine-specific repression of the carAB operon
binds to PepA |
| References for function | Kholti A, Charlier D, Gigot D, Huysveld N, Roovers M, Glansdorff N. pyrH-encoded UMP-kinase directly participates in pyrimidine-specific modulation of promoter activity in Escherichia coli. J Mol Biol. 1998 Jul 24. PMID: 9677289 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |