| General Information |
| MoonProt ID | 206 |
| First appeared in release | 1.0 |
| Name(s) | Acetyl esterase
EcE
Gene Name:aes |
| UniProt ID | P23872 (AES_ECOLI), Reviewed |
| GO terms | GO:0008152 metabolic process
GO:0043433 negative regulation of sequence-specific DNA binding transcription factor activity
GO:0051346 negative regulation of hydrolase activity
GO:0005515 protein binding
GO:0008126 acetylesterase activity
GO:0016787 hydrolase activity
GO:0034338 short-chain carboxylesterase activity
GO:0052689 carboxylic ester hydrolase activity
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Escherichia coli (Gram negative bacterium) |
| Sequence length | 319 |
| FASTA sequence | >sp|P23872|AES_ECOLI Acetyl esterase OS=Escherichia coli (strain K12) GN=aes PE=1 SV=3
MKPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
|
| Structure Information |
| PDB ID | 4KRX
4KRY |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.40.50.1820 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-8, 46-53, 317-319 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | esterase, enzyme
esterase of short chain fatty esters with up to 8 carbons in acyl chain |
| References for function | Peist R, Koch A, Bolek P, Sewitz S, Kolbus T, Boos W. Characterization of the aes gene of Escherichia coli encoding an enzyme with esterase activity. J Bacteriol. 1997 Dec. PMID: 9401025.
Haruki M, Oohashi Y, Mizuguchi S, Matsuo Y, Morikawa M, Kanaya S. Identification of catalytically essential residues in Escherichia coli esterase by site-directed mutagenesis. FEBS Lett. 1999 Jul 9. PMID: 10431819.
Kanaya S, Koyanagi T, Kanaya E. An esterase from Escherichia coli with a sequence similarity to hormone-sensitive lipase. Biochem J. 1998 May 15. PMID: 9576853. |
| E.C. number | 3.1.1.- |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | transcription regulation
binds to MalT activator of mal regulon and prevents its action |
| References for function | Joly N, Danot O, Schlegel A, Boos W, Richet E. The Aes protein directly controls the activity of MalT, the central transcriptional activator of the Escherichia coli maltose regulon. J Biol Chem. 2002 May 10. PMID: 11867639 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |