| General Information |
| MoonProt ID | 208 |
| First appeared in release | 1.0 |
| Name(s) | Trifunctional NAD biosynthesis/regulator protein NadR
Transcriptional regulator NadR
Nicotinamide mononucleotide adenylyltransferase
NMN adenylyltransferase
NMN-AT
NMNAT
Nicotinamide ribonucleotide adenylyltransferase
Nicotinamide-nucleotide adenylyltransferase
Ribosylnicotinamide kinase
RNK
Nicotinamide riboside kinase
NRK
NmR-K
Gene Name:nadR
***This protein has two different enzyme functions. We consider it to be a Moonlighting Protein because it has a transcription repressor function in addition to the enzyme functions.**** |
| UniProt ID | P27278 (NADR_ECOLI), Reviewed |
| GO terms | GO:0006351 transcription, DNA-templated
GO:0006355 regulation of transcription, DNA-templated
GO:0006810 transport
GO:0008152 metabolic process
GO:0009058 biosynthetic process
GO:0009435 NAD biosynthetic process
GO:0016310 phosphorylation
GO:0019363 pyridine nucleotide biosynthetic process
GO:0045892 negative regulation of transcription, DNA-templated
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0000309 nicotinamide-nucleotide adenylyltransferase activity GO:0000986 bacterial-type RNA polymerase core promoter proximal region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0043565 sequence-specific DNA binding
GO:0050262 ribosylnicotinamide kinase activity
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane |
| Organisms for which functions have been demonstrated | Escherichia coli (Gram negative bacterium) |
| Sequence length | 410 |
| FASTA sequence | >sp|P27278|NADR_ECOLI Trifunctional NAD biosynthesis/regulator protein NadR OS=Escherichia coli (strain K12) GN=nadR PE=1 SV=2
MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFPRQKKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGFDDTRDRALFEDSAMSQQPTVPDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKKFMAEKGIQPDLIYTSEEADAPQYMEHLGIETVLVDPKRTFMSISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR
|
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-6, 110-114, 405-410 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | nicotinamide mononucleotide (NMN) adenylyltransferase and ribosylnicotinamide (RN) kinase activities, enzyme
ATP + nicotinamide ribonucleotide => diphosphate + NAD+
ATP + 1-(beta-D-ribofuranosyl)-nicotinamide => ADP + beta-nicotinamide D-ribonucleotide
NAD biosynthesis |
| References for function | |
| E.C. number | 2.7.7.1 and 2.7.1.22 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Transcriptional repressor
binds to the nadB operator DNA sequence
Increasing NAD causes an increase in the affinity of NadR for the nadB operator regions of nadA, nadB, and pncB |
| References for function | Raffaelli N, Lorenzi T, Mariani PL, Emanuelli M, Amici A, Ruggieri S, Magni G. The Escherichia coli NadR regulator is endowed with nicotinamide mononucleotide adenylyltransferase activity. J Bacteriol. 1999 Sep. PMID: 10464228 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, binds to DNA |
| Comments | |