| General Information |
| MoonProt ID | 215 |
| First appeared in release | 1.0 |
| Name(s) | Formiminotransferase
glutamate formiminotransferase
FT |
| UniProt ID | Q9HI69 (Q9HI69_THEAC), Unreviewed |
| GO terms | GO:0008152 metabolic process
GO:0005542 folic acid binding
GO:0016740 transferase activity |
| Organisms for which functions have been demonstrated | Thermoplasma acidophilum |
| Sequence length | 303 |
| FASTA sequence | >tr|Q9HI69|Q9HI69_THEAC Probable glutamate formiminotransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1476 PE=4 SV=1
MSLVECVPNFSEGRDRDRVNRIRDAIASVDTVKILDVEMDPNHNRSVITFVCDSSKAVDAAFAGIKAAAEIIDMDAHRGEHPRFGAADVIPFVPLQDTKMETCVRLARDLGKRVGEELGIPVYLYAEAAQRPDRSDLAAIRNKNFQYEQLKEAIKEEKWKPDFGPSVVGKAGASIIGARDFLIAYNVNLNTSNMEIGKKIASAIRAKDGGLTFVKSLAFFLKDKNMVQISMNLTNYRKTPIYRAYELVRLEAARYGVLPVESEIVGLVPEQALIDVAKYYLQLNGFDEGNILERKMEKAANME
|
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-8), and C terminus (aa 297-303) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | formiminotransferase, enzyme
histidine breakdown |
| References for function | Jeanguenin L, LaraN??ez A, Pribat A, Mageroy MH, Gregory JF, Rice KC, de Cr?cyLagard, Hanson AD. Moonlighting glutamate formiminotransferases can functionally replace 5-formyltetrahydrofolate cycloligase. J Biol Chem. 2010 Dec 31. PMID: 20952389 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | 5-formyltetrahydrofolate cycloligase
ATP + 5-formyltetrahydrofolate <=> ADP + phosphate + 5,10-methenyltetrahydrofolate |
| References for function | Jeanguenin L, LaraN??ez A, Pribat A, Mageroy MH, Gregory JF, Rice KC, de Cr?cyLagard, Hanson AD. Moonlighting glutamate formiminotransferases can functionally replace 5-formyltetrahydrofolate cycloligase. J Biol Chem. 2010 Dec 31. PMID: 20952389 |
| E.C. number | 6.3.3.2 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |