| General Information |
| MoonProt ID | 217 |
| First appeared in release | 1.0 |
| Name(s) | Sarcosine oxidase, beta subunit
SOX
L-proline dehydrogenase |
| UniProt ID | Q5JFG7 (Q5JFG7_THEKO), Unreviewed |
| GO terms | GO:0055114 oxidation-reduction process
GO:0016491 oxidoreductase activity |
| Organisms for which functions have been demonstrated | Thermococcus kodakarensis |
| Sequence length | 386 |
| FASTA sequence | >tr|Q5JFG7|Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0117 PE=4 SV=1
MPTRELPEKSEITIIGGGIVGVTIAHELAKRGEEVTVIEKRFIGSGSTFRCGTGIRQQFNDEANVQVMKRSVELWKKYSEEYGFPFQQTGYLFLLYDDEEVETFKRNIAIQNKFGVPTRLITPEEAKEIVPLLDISEVVAASWNPTDGKASPFHSTAKFALHAEEFGAKLVEYTEVKDFIIENGEIKGLKTSRGTIKTGIVVNATNAWAKLINAMAGIRTKIPIEPYKHQAVITQPIKKGSVKPMVISFRYGHAYLTQTSHGGIIGGVGYEEGPTYDLNPTYEFLREVSYYFTKIIPALRELLILRTWAGYYAKTPDSNPAIGKIEELSDYYIAAGFSGHGFMMAPAVAEMVADLITKGKTDLPAWWYDPYRFERGELRGKALQMG
|
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-5, 379-386 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Sarcosine oxidase, enzyme
oxidation of the methyl group in sarcosine and transfer to folate oxidative demethylation of sarcosine to yield glycine and 5,10-CH2-tetrahydrofolate |
| References for function | Lee S, Jia B, Pham BP, Shao Y, Kwak JM, Cheong GW. Architecture and characterization of sarcosine oxidase from Thermococcus kodakarensis KOD1. Extremophiles. 2012 Jan. PMID: 22083128 |
| E.C. number | 1.5.3.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | L-proline dehydrogenase, enzyme
L-proline + acceptor <=> (S)-1-pyrroline-5-carboxylate + reduced acceptor
|
| References for function | Lee S, Jia B, Pham BP, Shao Y, Kwak JM, Cheong GW. Architecture and characterization of sarcosine oxidase from Thermococcus kodakarensis KOD1. Extremophiles. 2012 Jan. PMID: 22083128 |
| E.C. number | 1.5.99.8 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |