| General Information |
| MoonProt ID | 224 |
| First appeared in release | 1.0 |
| Name(s) | Bifunctional protein PyrR
Pyrimidine operon regulatory protein
Uracil phosphoribosyltransferase
UPRTase
Gene Name:pyrR |
| UniProt ID | P41007 (PYRR_BACCL), Reviewed |
| GO terms | GO:0006351 transcription, DNA-templated
GO:0006353 DNA-templated transcription, termination
GO:0006355 regulation of transcription, DNA-templated
GO:0009116 nucleoside metabolic process
GO:0003723 RNA binding
GO:0004845 uracil phosphoribosyltransferase activity
GO:0016740 transferase activity
GO:0016757 transferase activity, transferring glycosyl groups
|
| Organisms for which functions have been demonstrated | Bacillus caldolyticus |
| Sequence length | 179 |
| FASTA sequence | >sp|P41007|PYRR_BACCL Bifunctional protein PyrR OS=Bacillus caldolyticus GN=pyrR PE=1 SV=1
MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRDDLTVKTDDHEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK
|
| Structure Information |
| PDB ID | 1NON
1XZ8
1XZN
2IGB |
| Quaternary structure | |
| SCOP | PRTase-like |
| CATH | 3.40.50.2020 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 2, 80-82, 177-179 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | uracil phosphoribosyltransferase, enzyme
UMP + diphosphate <=> uracil + 5-phospho-alpha-D-ribose 1-diphosphate
|
| References for function | Ghim SY, Neuhard J. The pyrimidine biosynthesis operon of the thermophile Bacillus caldolyticus includes genes for uracil phosphoribosyltransferase and uracil permease. J Bacteriol. 1994 Jun. PMID: 8206848 |
| E.C. number | 2.4.2.9 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds mRNA
transcriptional attenuation of the pyrimidine nucleotide biosynthetic (pyr) operon
binds upstream of the genes being regulated |
| References for function | Switzer RL, Turner RJ, Lu Y. Regulation of the Bacillus subtilis pyrimidine biosynthetic operon by transcriptional attenuation: control of gene expression by an mRNA-binding protein. Prog Nucleic Acid Res Mol Biol. 1999 0. PMID: 9932459 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |