| General Information |
| MoonProt ID | 225 |
| First appeared in release | 1.0 |
| Name(s) | Creatine kinase B-type
B-CK
Creatine kinase B chain
Gene Name:Ckb |
| UniProt ID | P07335 (KCRB_RAT), Reviewed |
| GO terms | GO:0006603 phosphocreatine metabolic process
GO:0007420 brain development
GO:0016310 phosphorylation
GO:0030644 cellular chloride ion homeostasis
GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0004111 creatine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0016772 transferase activity, transferring phosphorus-containing groups
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005886 plasma membrane
|
| Organisms for which functions have been demonstrated | Rattus norvegicus (rat, a mammal) |
| Sequence length | 381 |
| FASTA sequence | >sp|P07335|KCRB_RAT Creatine kinase B-type OS=Rattus norvegicus GN=Ckb PE=1 SV=2
MPFSNSHNTQKLRFPAEDEFPDLSSHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQTGVDNPGHPYIMTVGAVAGDEESYDVFKDLFDPIIEDRHGGYQPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQPIDDLMPAQK
|
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-13, 326, 372-381 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | creatine kinase, enzyme
transfers phosphoryl group between ATP and various phosphogens (e.g. creatine phosphate)
ATP + creatine <=> ADP + phosphocreatine |
| References for function | |
| E.C. number | 2.7.3.2 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds mRNA
translation regulator
binds 3' untranslated region (3' UTR) of mRNA of alpha myosin heavy chain (alphaMyHC)
|
| References for function | VracarGrabar M, Russell B. Creatine kinase is an alpha myosin heavy chain 3'UTR mRNA binding protein. J Muscle Res Cell Motil. 2004 0. PMID: 15548869 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |