| General Information |
| MoonProt ID | 242 |
| First appeared in release | 1.0 |
| Name(s) | Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
Multisynthase complex auxiliary component p38
Protein JTV-1
Gene Name: Aimp2 |
| UniProt ID | Q8R010 (AIMP2_MOUSE), Reviewed |
| GO terms | GO:0006412 translation
GO:0006915 apoptotic process
GO:0007275 multicellular organismal development
GO:0008285 negative regulation of cell proliferation
GO:0030154 cell differentiation
GO:0031398 positive regulation of protein ubiquitination
GO:0060510 Type II pneumocyte differentiation
GO:0005515 protein binding
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
|
| Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
| Sequence length | 320 |
| FASTA sequence | >sp|Q8R010|AIMP2_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Mus musculus GN=Aimp2 PE=1 SV=2
MPMYQVKPYHGGSAPLHVELPTCMYRLPNVHSKTTSPATDAGHVQETSEPSLQALESRQDDILKRLYELKAAVDGLSKMIHTPDADLDVTNILQADEPTTLATNTLDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCERYRVLSTVHTHSSVKNVPENLVKCFGEQARKQSRHEYQLGFTLIWKNVPKTQMKFSVQTMCPIEGEGNIARFLFSLFGQKHNAVTLTLIDSWVDIAMFQLREGSSKEKAAVFRSMNSALGRSPWLVGNELTVADVVLWSVLQQTGGSSGAAPTNVQRWLKSCENLAPFSTALQLLK
|
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-4, 6-10, 36-50, 97-106, 315-320 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | scaffold protein in the multisynthase complex forms a multi-protein complex with glutamyl-, prolyl-, isoelucyl-, leucyl-, methionyl-, glutaminyl-, lysyl-, arginyl-, and aspartyl-tRNA synthetases, AIMP1/p24, and AIMP3/p18 |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to FUSE-binding protein (FBP), a transcriptional activator of c-myc
the protein-protein interaction causes an increase in the ubiquitination and degradation of FBP, which results in downregulation of c-myc
differentiation of lung cells
|
| References for function | Kim MJ, Park BJ, Kang YS, Kim HJ, Park JH, Kang JW, Lee SW, Han JM, Lee HW, Kim S. Downregulation of FUSE-binding protein and c-myc by tRNA synthetase cofactor p38 is required for lung cell differentiation. Nat Genet. 2003 Jul. PMID: 12819782 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |