| General Information |
| MoonProt ID | 248 |
| First appeared in release | 1.0 |
| Name(s) | S8 ribosomal protein
30S ribosomal protein S8
Gene Name: rpsH |
| UniProt ID | P0A7W7 (RS8_ECOLI), Reviewed |
| GO terms | GO:0006412 translation
GO:0006417 regulation of translation
GO:0043488 regulation of mRNA stability
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030529 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Escherichia coli (Gram negative bacterium) |
| Sequence length | 130 |
| FASTA sequence | >sp|P0A7W7|RS8_ECOLI 30S ribosomal protein S8 OS=Escherichia coli (strain K12) GN=rpsH PE=1 SV=2
MSMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
|
| Structure Information |
| PDB ID | 1VS5, 1VS7, 3E1A, 3E1C, 3I1M, 3I1O, 3I1Q, 3I1S, 3I1Z, 3I21, 3KC4, 3OR9, 3ORA, 3IZV, 3IZW, 3SFS, 3UOQ, 4GAQ, 4GAS, 4KIY, 4KJ0, 4KJ2, 4KJ4, 4KJ6, 4KJ8, 4KJA, 4KJC, 3J4V, 3J4W, 3J4Y, 3J4Z, 3J53, 1P87, 1S03, 2AVY, 2AW7, 2I2P, 2I2U, 2QOU, 2QOW, 2QOY, 2OP0, 2QA |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-9), and C terminus (aa 129-130) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | S8 ribosomal protein
part of the 30S subunit
binds to 16S rRNA
|
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | translational repressor
inhibits expression of some proteins encoded by the spc operon |
| References for function | Yates JL, Arfsten AE, Nomura M. In vitro expression of Escherichia coli ribosomal protein genes: autogenous inhibition of translation. Proc Natl Acad Sci U S A. 1980 Apr. PMID: 6445562 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |