General Information |
MoonProt ID | 258 |
First appeared in release | 1.0 |
Name(s) | Peptidyl-tRNA hydrolase 2, mitochondrial
PTH 2
Bcl-2 inhibitor of transcription 1
Gene Name:PTRH2 |
UniProt ID | Q9Y3E5 (PTH2_HUMAN), Reviewed |
GO terms | GO:0006915 apoptotic process
GO:0008152 metabolic process
GO:0010629 negative regulation of gene expression
GO:2000210 positive regulation of anoikis
GO:2000811 negative regulation of anoikis
GO:0004045 aminoacyl-tRNA hydrolase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0005739 mitochondrion
GO:0005829 cytosol |
Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
Sequence length | 179 |
FASTA sequence | >sp|Q9Y3E5|PTH2_HUMAN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens GN=PTRH2 PE=1 SV=1
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
|
Structure Information |
PDB ID | 1Q7S |
Quaternary structure | |
SCOP | NA |
CATH | 3.40.1490.10 |
TM Helix Prediction | (15-37)mitochondrian transport peptide |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-9, 42-57 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Peptidyl-tRNA hydrolase, enzyme
aminoacyl-tRNA + H2O => amino acid + tRNA
releases tRNA from the premature translation termination product
|
References for function | De Pereda, Waas WF, Jan Y, Ruoslahti E, Schimmel P, Pascual J. Crystal structure of a human peptidyl-tRNA hydrolase reveals a new fold and suggests basis for a bifunctional activity. J Biol Chem. 2004 Feb 27;279(9):8111-5.
PMID: 14660562 |
E.C. number | 3.1.1.29 |
Location of functional site(s) | |
Cellular location of function | mitochondrion |
Comments | |
Function 2 |
Function description | inhibitor of transcription
protein-protein interaction |
References for function | De Pereda, Waas WF, Jan Y, Ruoslahti E, Schimmel P, Pascual J. Crystal structure of a human peptidyl-tRNA hydrolase reveals a new fold and suggests basis for a bifunctional activity. J Biol Chem. 2004 Feb 27;279(9):8111-5.
PMID: 14660562 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | mitochondrion |
Comments | |