| General Information |
| MoonProt ID | 263 |
| First appeared in release | 1.0 |
| Name(s) | Peroxiredoxin 2
TSA2
Cytoplasmic thiol peroxidase 2
cTPx 2
Thiol-specific antioxidant protein 2
Thioredoxin peroxidase 2
Gene Name:TSA2 |
| UniProt ID | Q04120 (TSA2_YEAST), Reviewed |
| GO terms | GO:0034599 cellular response to oxidative stress
GO:0045454 cell redox homeostasis
GO:0055114 oxidation-reduction process
GO:0004601 peroxidase activity
GO:0008379 thioredoxin peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 196 |
| FASTA sequence | >sp|Q04120|TSA2_YEAST Peroxiredoxin TSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA2 PE=1 SV=3
MVAEVQKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVLFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEGIALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGAATIKPDVKDSKEYFKNANN
|
| Structure Information |
| PDB ID | 5EPT |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), and C terminus (aa 188-196) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | peroxiredoxin
peroxidase
antioxidant
2 R'-SH + ROOH => R'-S-S-R' + H2O + ROH |
| References for function | |
| E.C. number | 1.11.1.15 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | molecular chaperones
helps proteins fold |
| References for function | Jang HH, Lee KO, Chi YH, Jung BG, Park SK, Park JH, Lee JR, Lee SS, Moon JC, Yun JW, Choi YO, Kim WY, Kang JS, Cheong GW, Yun DJ, Rhee SG, Cho MJ, Lee SY. Two enzymes in one; two yeast peroxiredoxins display oxidative stress-dependent switching from a peroxidase to a molecular chaperone function. Cell. 2004 May 28;117(5):625-35.
PMID: 15163410 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |