Protein Information

General Information
MoonProt ID283
First appeared in release1.0
Name(s)50S ribosomal protein L10 Gene Name: rplJ
UniProt IDP0A7J3
GO termsGO:0006412 translation GO:0042254 ribosome biogenesis GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0019843 rRNA binding GO:0070180 LSU rRNA binding GO:0005622 intracellular GO:0005840 ribosome GO:0030529 ribonucleoprotein complex
Organisms for which functions have been demonstratedEscherichia coli
Sequence length165 aa
FASTA sequence>sp|P0A7J3|RL10_ECOLI 50S ribosomal protein L10 OS=Escherichia coli (strain K12) GN=rplJ PE=1 SV=2 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
Structure Information
PDB ID3UOS, 4KIX, 4KIZ, 4KJ1, 4KJ5, 4KJ9, 3J5O, 3J5U, 3J5W, 2SGF, 2J0W, 3J0Y, 3J11, 3J12, 3J14, 3J37, 3J0T
Quaternary structure
Function 1
Function descriptionribosomal protein part of the 50S subunit
References for function
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of the ribosome
Comments
Function 2
Function descriptiontranslation inhibitor autogenous regulation of translation
References for functionBrot N, Caldwell P, Weissbach H. Autogenous control of Escherichia coli ribosomal protein L10 synthesis in vitro. Proc Natl Acad Sci U S A. 1980 May. PMID: 6994102
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments