| General Information |
| MoonProt ID | 283 |
| First appeared in release | 1.0 |
| Name(s) | 50S ribosomal protein L10
Gene Name: rplJ |
| UniProt ID | P0A7J3 |
| GO terms | GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 LSU rRNA binding
GO:0005622 intracellular
GO:0005840 ribosome
GO:0030529 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Escherichia coli (Gram negative bacterium) |
| Sequence length | 165 aa |
| FASTA sequence | >sp|P0A7J3|RL10_ECOLI 50S ribosomal protein L10 OS=Escherichia coli (strain K12) GN=rplJ PE=1 SV=2
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
|
| Structure Information |
| PDB ID | NA |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-5, 160-165 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ribosomal protein
part of the 50S subunit
|
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, part of the ribosome |
| Comments | |
| Function 2 |
| Function description | translation inhibitor
autogenous regulation of translation
|
| References for function | Brot N, Caldwell P, Weissbach H. Autogenous control of Escherichia coli ribosomal protein L10 synthesis in vitro. Proc Natl Acad Sci U S A. 1980 May. PMID: 6994102 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |