| General Information |
| MoonProt ID | 287 |
| First appeared in release | 1.0 |
| Name(s) | dCTP deaminase, dUMP-forming
Bifunctional deaminase/diphosphatase
MjDCD-DUT
DCD/DUT
Gene Name:dcd |
| UniProt ID | Q57872 (DCD_METJA), Reviewed |
| GO terms | GO:0006226 dUMP biosynthetic process
GO:0006229 dUTP biosynthetic process
GO:0009117 nucleotide metabolic process
GO:0009220 pyrimidine ribonucleotide biosynthetic process
GO:0046080 dUTP metabolic process
GO:0008829 dCTP deaminase activity
GO:0016787 hydrolase activity
GO:0033973 dCTP deaminase (dUMP-forming) activity |
| Organisms for which functions have been demonstrated | Methanocaldococcus jannaschii |
| Sequence length | 204 |
| FASTA sequence | >sp|Q57872|DCD_METJA dCTP deaminase, dUMP-forming OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dcd PE=1 SV=1
MILSDKDIIDYVTSKRIIIKPFNKDFVGPCSYDVTLGDEFIIYDDEVYDLSKELNYKRIKIKNSILVCPLNYNLTEEKINYFKEKYNVDYVVEGGVLGTTNEYIELPNDISAQYQGRSSLGRVFLTSHQTAGWIDAGFKGKITLEIVAFDKPVILYKNQRIGQLIFSKLLSPADVGYSERKTSKYAYQKSVMPSLIHLDNHKKD
|
| Structure Information |
| PDB ID | 1OGH, 1PKH, 1PKJ, 1PKK, 2HXB, E145,
3GF0, 2HXD |
| Quaternary structure | |
| SCOP | beta-clip |
| CATH | 2.70.40.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 74-80, 193-204 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | dCTP deaminase
deamination of the cytosine moiety in dCTP
dCTP + 2 H2O => dUMP + diphosphate + NH3
Pyrimidine metabolism, dUMP biosynthesis |
| References for function | |
| E.C. number | 3.5.4.13 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | hydrolysis of the triphosphate moiety forming dUMP
dUTP => dUMP |
| References for function | Johansson E, Bjornberg O, Nyman PO, Larsen S. Structure of the bifunctional dCTP deaminase-dUTPase from Methanocaldococcus jannaschii and its relation to other homotrimeric dUTPases. J Biol Chem. 2003 Jul 25;278(30):27916-22.
PMID: 12756253 |
| E.C. number | 3.6.1.23 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |