| General Information |
| MoonProt ID | 288 |
| First appeared in release | 1.0 |
| Name(s) | Penicillin binding protein 4
D-alanyl-D-alanine carboxypeptidase DacB
DD-carboxypeptidase
DD-peptidase
D-alanyl-D-alanine endopeptidase
DD-endopeptidase
Penicillin-binding protein 4
PBP-4
Gene Name: dacB |
| UniProt ID | P24228 (DACB_ECOLI), Reviewed |
| GO terms | GO:0000270 peptidoglycan metabolic process
GO:0006508 proteolysis
GO:0007049 cell cycle
GO:0008360 regulation of cell shape
GO:0009252 peptidoglycan biosynthetic process
GO:0009253 peptidoglycan catabolic process
GO:0009254 peptidoglycan turnover
GO:0016998 cell wall macromolecule catabolic process
GO:0043093 cytokinesis by binary fission
GO:0046677 response to antibiotic
GO:0051301 cell division
GO:0071555 cell wall organization
GO:0004175 endopeptidase activity
GO:0004180 carboxypeptidase activity
GO:0004185 serine-type carboxypeptidase activity
GO:0005515 protein binding
GO:0008658 penicillin binding
GO:0009002 serine-type D-Ala-D-Ala carboxypeptidase activity
GO:0009002 serine-type D-Ala-D-Ala carboxypeptidase activity
GO:0016787 hydrolase activity
GO:0030288 outer membrane-bounded periplasmic space
GO:0042597 periplasmic space |
| Organisms for which functions have been demonstrated | Escherichia coli (Gram negative bacterium) |
| Sequence length | 477 |
| FASTA sequence | >sp|P24228|DACB_ECOLI D-alanyl-D-alanine carboxypeptidase DacB OS=Escherichia coli (strain K12) GN=dacB PE=1 SV=2
MRFSRFIIGLTSCIAFSVQAANVDEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKDELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
|
| Structure Information |
| PDB ID | 2EX2, 2EX6, 2EX8, 2EX9, 2EXA, 16411754 |
| E.C. number | 3.4.21.- |
| Location of functional site(s) | |
| Cellular location of function | periplasm |
| Comments | |