| General Information |
| MoonProt ID | 296 |
| First appeared in release | 4.0 |
| Name(s) | aldolase C |
| UniProt ID | P05063 |
| GO terms | GO:0004332 fructose-bisphosphate aldolase activity
GO:0008092 cytoskeletal protein binding
GO:0016829 lyase activity
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0006094 gluconeogenesis
GO:0006096 glycolytic process
GO:0019318 hexose metabolic process
GO:0030388 fructose 1,6-bisphosphate metabolic process
GO:0030855 epithelial cell differentiation
GO:0005829 cytosol
GO:0099524 postsynaptic cytosol
GO:0005739 mitochondrion
GO:0030424 axon |
| Organisms for which functions have been demonstrated | Mus musculus |
| Sequence length | 363 |
| FASTA sequence | >sp|P05063|ALDOC_MOUSE Fructose-bisphosphate aldolase C OS=Mus musculus OX=10090 GN=Aldoc PE=1 SV=4
MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTD
GETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTF
SYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRYEGSGDGGAAAQSLYIAN
HAY |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | NA |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-9), and C terminus (aa 360-363) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, fructose bisphosphate aldolase |
| References for function | NA |
| E.C. number | 4.1.2.13 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds RNA and regulates translation |
| References for function | Canete-Soler R, Reddy KS, Tolan DR, Zhai J. Aldolases a and C are ribonucleolytic components of a neuronal complex that regulates the stability of the light-neurofilament mRNA. J Neurosci. 2005 Apr 27;25(17):4353-64. doi: 10.1523/JNEUROSCI.0885-05.2005. Erratum in: J Neurosci. 2006 May 10;26(19):5276. PMID: 15858061; PMCID: PMC6725117. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |