| General Information |
| MoonProt ID | 306 |
| First appeared in release | 2.0 |
| Name(s) | fructose bisphosphate aldolase (FBA), fructose-bisphosphate aldolase, fructose 1,6-bisphosphate aldolase, Gene: fba |
| UniProt ID | P0A4S2 (ALF_STRR6) |
| GO terms | GO:0005975 carbohydrate metabolic process
GO:0006096 glycolytic process
GO:0030388 fructose 1,6-bisphosphate metabolic process
GO:0003824 catalytic activity
GO:0004332 fructose-bisphosphate aldolase activity
GO:0008270 zinc ion binding
GO:0016829 lyase activity
GO:0016832 aldehyde-lyase activity
GO:0046872 metal ion binding |
| Organisms for which functions have been demonstrated | Streptococcus pneumoniae (Gram positive bacterium) |
| Sequence length | 293 amino acids |
| FASTA sequence | >sp|P0A4S2|ALF_STRR6 Fructose-bisphosphate aldolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fba PE=1 SV=1
MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPVLIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIMFDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMVETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAIKLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVEERIDVFGSEGKA |
| Structure Information |
| PDB ID | non, but structures available of some homologues |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 253-256, 290-293 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | fructose bisphosphate aldolase, enzyme, in glycolysis and gluconeogenesis, D-fructose 1,6-bisphosphate -> dihydroxyacetone phosphate + D-glyceraldehyde 3-phosphate |
| References for function | Jado I., Fenoll A., Cepeda T., Casal J., Perez A. Cloning, sequencing, and chromosomal location of a putative class-II aldolase gene from Streptococcus pneumoniae. Curr. Microbiol. 39:31-36(1999) PMID: 10387114 |
| E.C. number | 4.1.2.13 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds to receptor on host cells, binds to host Flamingo cadherin receptor (FCR) |
| References for function | Blau K, Portnoi M, Shagan M, Kaganovich A, Rom S, Kafka D, Chalifa Caspi V, Porgador A, Givon-Lavi N, Gershoni JM, Dagan R, Mizrachi Nebenzahl Y. Flamingo cadherin: a putative host receptor for Streptococcus pneumoniae. J Infect Dis. 2007 Jun 15;195(12):1828-37. PMID: 17492599 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell wall |
| Comments | |