Protein Information

General Information
MoonProt ID308
First appeared in release2.0
Name(s)alpha-ketoglutarate dehydrogenase E2, dihydrolipoyl succinyltransferase, alpha-KDE2, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative Gene: Tb11.01.3550
UniProt IDQ383B2 (Q383B2_TRYB2)
GO termsGO:0008152 metabolic process GO:0004149 dihydrolipoyllysine-residue succinyltransferase activity GO:0016740 transferase activity GO:0016746 transferase activity, transferring acyl groups GO:0005739 mitochondrion
Organisms for which functions have been demonstratedTrypanosoma brucei
Sequence length383 amino acids
FASTA sequence>tr|Q383B2|Q383B2_TRYB2 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb11.01.3550 PE=3 SV=1 MLRRLATHGLQATCLTSEKLAYRYCLSICVPTIAESISSGKVVGWTKKVGDAVAEDEIICQIESDKLNVDVRAPAAGVITKINFEEGTVVDVGAELSTMKEGEAPAAKAETADKPKQNAPAAAAPPKASPTEAAPKPAPAAAPVTSRGADPRVRSVRISSMRQRIADRLKASQNTCAMLTTFNEIDMTPLIELRNRYKDDFFKKNGVKLGFMSPFVKACAIALQDVPIVNASFGTDCIEYHDYVDISVAVSTPKGLVVPVLRDVQNSNFAQIEKQIADFGERARSNKLTMAEMTGGTFTISNGGVFGSWMGTPIVNPPQSAILGMHATKKKPWVVGNSVVPRDIMAVALTYDHRLIDGSDAVTFLVKVKNLIEDPARIVLDLA
Structure Information
PDB IDnone, closes homologue is 54% identical
Quaternary structurepart of large complex with E1 and E3
Function 1
Function descriptionalpha-ketoglutarate dehydrogenase E2, in Krebs cycle, dihydrolipoyl succinyltransferase
References for function
E.C. number2.3.1.61
Location of functional site(s)
Cellular location of functionmitochondrial matrix and inner membrane
CommentsKrebs cycle not functional in bloodstream form of parasite, used only for other function there
Function 2
Function descriptionmitochondrial DNA inheritance
References for functionSykes SE, Hajduk SL.Dual functions of alpha-ketoglutarate dehydrogenase E2 in the Krebs cycle and mitochondrial DNA inheritance in Trypanosoma brucei. Eukaryot Cell. 2013 Jan;12(1):78-90. doi: 10.1128/EC.00269-12. PMID: 23125353
E.C. number
Location of functional site(s)
Cellular location of functionbinds kinetoplast DNA
Comments