| General Information |
| MoonProt ID | 308 |
| First appeared in release | 2.0 |
| Name(s) | alpha-ketoglutarate dehydrogenase E2, dihydrolipoyl succinyltransferase, alpha-KDE2, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative
Gene: Tb11.01.3550 |
| UniProt ID | Q383B2 (Q383B2_TRYB2) |
| GO terms | GO:0008152 metabolic process
GO:0004149 dihydrolipoyllysine-residue succinyltransferase activity
GO:0016740 transferase activity
GO:0016746 transferase activity, transferring acyl groups
GO:0005739 mitochondrion |
| Organisms for which functions have been demonstrated | Trypanosoma brucei |
| Sequence length | 383 amino acids |
| FASTA sequence | >tr|Q383B2|Q383B2_TRYB2 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb11.01.3550 PE=3 SV=1
MLRRLATHGLQATCLTSEKLAYRYCLSICVPTIAESISSGKVVGWTKKVGDAVAEDEIICQIESDKLNVDVRAPAAGVITKINFEEGTVVDVGAELSTMKEGEAPAAKAETADKPKQNAPAAAAPPKASPTEAAPKPAPAAAPVTSRGADPRVRSVRISSMRQRIADRLKASQNTCAMLTTFNEIDMTPLIELRNRYKDDFFKKNGVKLGFMSPFVKACAIALQDVPIVNASFGTDCIEYHDYVDISVAVSTPKGLVVPVLRDVQNSNFAQIEKQIADFGERARSNKLTMAEMTGGTFTISNGGVFGSWMGTPIVNPPQSAILGMHATKKKPWVVGNSVVPRDIMAVALTYDHRLIDGSDAVTFLVKVKNLIEDPARIVLDLA |
| Structure Information |
| PDB ID | none, closes homologue is 54% identical |
| Quaternary structure | part of large complex with E1 and E3 |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-14, 99-155, 383 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | alpha-ketoglutarate dehydrogenase E2, in Krebs cycle, dihydrolipoyl succinyltransferase |
| References for function | |
| E.C. number | 2.3.1.61 |
| Location of functional site(s) | |
| Cellular location of function | mitochondrial matrix and inner membrane |
| Comments | Krebs cycle not functional in bloodstream form of parasite, used only for other function there |
| Function 2 |
| Function description | mitochondrial DNA inheritance |
| References for function | Sykes SE, Hajduk SL.Dual functions of alpha-ketoglutarate dehydrogenase E2 in the Krebs cycle and mitochondrial DNA inheritance in Trypanosoma brucei. Eukaryot Cell. 2013 Jan;12(1):78-90. doi: 10.1128/EC.00269-12. PMID: 23125353 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | binds kinetoplast DNA |
| Comments | |