| General Information |
| MoonProt ID | 310 |
| First appeared in release | 2.0 |
| Name(s) | beta-arrestin 1, Beta-arrestin-1
Gene: ARRB1 |
| UniProt ID | P49407 (ARRB1_HUMAN) |
| GO terms | GO:0000187 activation of MAPK activity
GO:0001933 negative regulation of protein phosphorylation
GO:0001934 positive regulation of protein phosphorylation
GO:0002031 G-protein coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0006351 transcription, DNA-templated
GO:0006355 regulation of transcription, DNA-templated
GO:0006366 transcription from RNA polymerase II promoter
GO:0006810 transport
GO:0006897 endocytosis
GO:0007165 signal transduction
GO:0007186 G-protein coupled receptor signaling pathway
GO:0007602 phototransduction
GO:0008277 regulation of G-protein coupled receptor protein signaling pathway
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0016567 protein ubiquitination
GO:0030168 platelet activation
GO:0031397 negative regulation of protein ubiquitination |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 418 amino acids |
| FASTA sequence | >sp|P49407|ARRB1_HUMAN Beta-arrestin-1 OS=Homo sapiens GN=ARRB1 PE=1 SV=2
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR |
| Structure Information |
| PDB ID | Not human, but bovine has 99% sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-6, 91-94, 179-181, 356-376, 399-418 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | cytosolic regulator and scaffold of GPCR signaling, interacts with activated receptors at cell membrane, resulting in receptor endocytosis and attenuation of receptor signalling |
| References for function | |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm and cytoplasmic face of cell membrane |
| Comments | |
| Function 2 |
| Function description | regulation of histone acetylation and gene transcription, helps recruit histone acetyltransferase p300 to specific promoters, resulting in enhanced acetylation of histone H4 and transcription of those genes |
| References for function | Kang J, Shi Y, Xiang B, Qu B, Su W, Zhu M, Zhang M, Bao G, Wang F, Zhang X, Yang R, Fan F, Chen X, Pei G, Ma L. A nuclear function of beta-arrestin1 in GPCR signaling: regulation of histone acetylation and gene transcription. Cell. 2005 Dec 2;123(5):833-47. PMID: 16325578. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |